Initial commit:

PhysX 3.4.0 Update @ 21294896
APEX 1.4.0 Update @ 21275617

[CL 21300167]

35 files changed, 10616 insertions, 0 deletions

diff --git a/APEX_1.4/shared/external/include/ApexMaterial.h b/APEX_1.4/shared/external/include/ApexMaterial.h
new file mode 100644
index 00000000..252dd64f
--- /dev/null
+++ b/APEX_1.4/shared/external/include/ApexMaterial.h
@@ -0,0 +1,241 @@
+/*
+ * Copyright (c) 2008-2015, NVIDIA CORPORATION.  All rights reserved.
+ *
+ * NVIDIA CORPORATION and its licensors retain all intellectual property
+ * and proprietary rights in and to this software, related documentation
+ * and any modifications thereto.  Any use, reproduction, disclosure or
+ * distribution of this software and related documentation without an express
+ * license agreement from NVIDIA CORPORATION is strictly prohibited.
+ */
+
+#ifndef _MATERIAL_H_
+#define _MATERIAL_H_
+
+#include <stdio.h>
+#include <string>
+#include "ApexUsingNamespace.h"
+#include "RenderMesh.h"
+#include "MaterialLibrary.h"
+#include "PxVec3.h"
+#include <vector>
+
+/**
+	A generic texture map.  Loads from a variety of file formats, but is stored in a unified basic format.
+	May be (de)serialized from/to an physx::PxFileBuf.
+*/
+class ApexDefaultTextureMap : public TextureMap
+{
+public:
+	ApexDefaultTextureMap();
+	ApexDefaultTextureMap(const ApexDefaultTextureMap& textureMap)
+	{
+		*this = textureMap;
+	}
+	ApexDefaultTextureMap&	operator = (const ApexDefaultTextureMap& textureMap);
+	virtual					~ApexDefaultTextureMap();
+
+	void					build(PixelFormat format, uint32_t width, uint32_t height, uint32_t* fillColor = NULL);
+
+	/** Deallocates all buffers and sets all values to the default constructor values. */
+	void					unload();
+
+	/** Saves the generic texture data to an physx::PxFileBuf. */
+	void					serialize(physx::PxFileBuf& stream) const;
+
+	/** Loads generic texture data from an physx::PxFileBuf. */
+	void					deserialize(physx::PxFileBuf& stream, uint32_t version);
+
+	// Texture API
+	PixelFormat		getPixelFormat() const
+	{
+		return mPixelFormat;
+	}
+	uint32_t					getWidth() const
+	{
+		return mWidth;
+	}
+	uint32_t					getHeight() const
+	{
+		return mHeight;
+	}
+	uint32_t					getComponentCount() const
+	{
+		return mComponentCount;
+	}
+	uint32_t					getPixelBufferSize() const
+	{
+		return mPixelBufferSize;
+	}
+	uint8_t*					getPixels() const
+	{
+		return mPixelBuffer;
+	}
+
+protected:
+
+	PixelFormat	mPixelFormat;
+	uint32_t				mWidth;
+	uint32_t				mHeight;
+	uint32_t				mComponentCount;
+	uint32_t				mPixelBufferSize;
+	uint8_t*				mPixelBuffer;
+};
+
+
+class ApexDefaultMaterial : public Material
+{
+public:
+
+	ApexDefaultMaterial();
+	ApexDefaultMaterial(const ApexDefaultMaterial& material)
+	{
+		*this = material;
+	}
+	ApexDefaultMaterial&	operator = (const ApexDefaultMaterial& material);
+	virtual					~ApexDefaultMaterial();
+
+	/** Sets the name of the material, for lookup by the named resource provider. */
+	void					setName(const char* name);
+
+	/** Sets one of the material's texture maps (diffuse or normal) */
+	bool					setTextureMap(TextureMapType type, ApexDefaultTextureMap* textureMap);
+
+	/** Sets the ambient lighting color. */
+	void					setAmbient(const physx::PxVec3& ambient)
+	{
+		mAmbient = ambient;
+	}
+
+	/** Sets the diffuse lighting color. */
+	void					setDiffuse(const physx::PxVec3& diffuse)
+	{
+		mDiffuse = diffuse;
+	}
+
+	/** Sets the specular lighting color. */
+	void					setSpecular(const physx::PxVec3& specular)
+	{
+		mSpecular = specular;
+	}
+
+	/** Sets material's opacity. */
+	void					setAlpha(float alpha)
+	{
+		mAlpha = alpha;
+	}
+
+	/** Sets the material's shininess (specular power). */
+	void					setShininess(float shininess)
+	{
+		mShininess = shininess;
+	}
+
+	/** Deallocates all buffers and sets all values to the default constructor values. */
+	void					unload();
+
+	/** Saves the material to an physx::PxFileBuf. */
+	void					serialize(physx::PxFileBuf& stream) const;
+
+	/** Loads material from an physx::PxFileBuf. */
+	void					deserialize(physx::PxFileBuf& stream, uint32_t version);
+
+	// Material API
+	const char*				getName() const
+	{
+		return mName.c_str();
+	}
+	TextureMap*		getTextureMap(TextureMapType type) const;
+	const physx::PxVec3&			getAmbient() const
+	{
+		return mAmbient;
+	}
+	const physx::PxVec3&			getDiffuse() const
+	{
+		return mDiffuse;
+	}
+	const physx::PxVec3&			getSpecular() const
+	{
+		return mSpecular;
+	}
+	float					getAlpha() const
+	{
+		return mAlpha;
+	}
+	float					getShininess() const
+	{
+		return mShininess;
+	}
+
+private:
+
+	std::string				mName;
+
+	ApexDefaultTextureMap*	mTextureMaps[TEXTURE_MAP_TYPE_COUNT];
+
+	physx::PxVec3					mAmbient;
+	physx::PxVec3					mDiffuse;
+	physx::PxVec3					mSpecular;
+	float					mAlpha;
+	float					mShininess;
+};
+
+
+class ApexDefaultMaterialLibrary : public MaterialLibrary
+{
+public:
+
+	ApexDefaultMaterialLibrary();
+	ApexDefaultMaterialLibrary(const ApexDefaultMaterialLibrary& materialLibrary)
+	{
+		*this = materialLibrary;
+	}
+	ApexDefaultMaterialLibrary&	operator = (const ApexDefaultMaterialLibrary& material);
+	virtual						~ApexDefaultMaterialLibrary();
+
+	/** Deallocates all buffers and sets all values to the default constructor values. */
+	void						unload();
+
+	/** Returns the number of materials in the library */
+	uint32_t						getMaterialCount() const
+	{
+		return (uint32_t)mMaterials.size();
+	}
+
+	/**
+		Access to the materials by index.
+		Valid range of materialIndex is 0 to getMaterialCount()-1.
+	*/
+	ApexDefaultMaterial*		getMaterial(uint32_t materialIndex) const;
+
+	/**
+		Remove and delete named material.
+		Returns true if the material was found, false if it was not.
+	*/
+	virtual bool				deleteMaterial(const char* materialName);
+
+	/**
+		Adds the materials from the given materialLibrary, which
+		aren't already in this material library.  (Based upon name.)
+	*/
+	void						merge(const ApexDefaultMaterialLibrary& materialLibrary);
+
+	// MaterialLibrary API
+
+	/** Saves the material to an physx::PxFileBuf. */
+	void						serialize(physx::PxFileBuf& stream) const;
+
+	/** Loads material from an physx::PxFileBuf. */
+	void						deserialize(physx::PxFileBuf& stream);
+
+	Material*				getMaterial(const char* materialName, bool& created);
+
+	/* Returns -1 if the material is not found */
+	int32_t						findMaterialIndex(const char* materialName);
+
+private:
+
+	std::vector<ApexDefaultMaterial*>	mMaterials;
+};
+
+
+#endif // #ifndef _MATERIAL_H_
diff --git a/APEX_1.4/shared/external/include/BestFit.h b/APEX_1.4/shared/external/include/BestFit.h
new file mode 100644
index 00000000..876d6e49
--- /dev/null
+++ b/APEX_1.4/shared/external/include/BestFit.h
@@ -0,0 +1,48 @@
+/*
+ * Copyright (c) 2008-2015, NVIDIA CORPORATION.  All rights reserved.
+ *
+ * NVIDIA CORPORATION and its licensors retain all intellectual property
+ * and proprietary rights in and to this software, related documentation
+ * and any modifications thereto.  Any use, reproduction, disclosure or
+ * distribution of this software and related documentation without an express
+ * license agreement from NVIDIA CORPORATION is strictly prohibited.
+ */
+
+
+#ifndef BEST_FIT_H
+
+#define BEST_FIT_H
+
+// A code snippet to compute the best fit AAB, OBB, plane, capsule and sphere
+// Quaternions are assumed a float X,Y,Z,W
+// Matrices are assumed 4x4 D3DX style format passed as a float pointer
+// The orientation of a capsule is assumed that height is along the Y axis, the same format as the PhysX SDK uses
+// The best fit plane routine is derived from code previously published by David Eberly on his Magic Software site.
+// The best fit OBB is computed by first approximating the best fit plane, and then brute force rotating the points
+// around a single axis to derive the closest fit.  If you set 'bruteforce' to false, it will just use the orientation
+// derived from the best fit plane, which is close enough in most cases, but not all.
+// Each routine allows you to pass the point stride between position elements in your input vertex stream.
+// These routines should all be thread safe as they make no use of any global variables.
+
+
+
+namespace SharedTools
+{
+
+bool  computeBestFitPlane(size_t vcount,	// number of input data points
+                          const float* points,					// starting address of points array.
+                          size_t vstride,							// stride between input points.
+                          const float* weights,					// *optional point weighting values.
+                          size_t wstride,							// weight stride for each vertex.
+                          float plane[4]);
+
+float  computeBestFitAABB(size_t vcount, const float* points, size_t pstride, float bmin[3], float bmax[3]); // returns the diagonal distance
+float  computeBestFitSphere(size_t vcount, const float* points, size_t pstride, float center[3]);
+void   computeBestFitOBB(size_t vcount, const float* points, size_t pstride, float* sides, float matrix[16], bool bruteForce);
+void   computeBestFitOBB(size_t vcount, const float* points, size_t pstride, float* sides, float pos[3], float quat[4], bool bruteForce);
+void   computeBestFitCapsule(size_t vcount, const float* points, size_t pstride, float& radius, float& height, float matrix[16], bool bruteForce);
+void   computeBestFitCapsule(size_t vcount, const float* points, size_t pstride, float& radius, float& height, float pos[3], float quat[4], bool bruteForce);
+
+};
+
+#endif
diff --git a/APEX_1.4/shared/external/include/ClothingAuthoring.h b/APEX_1.4/shared/external/include/ClothingAuthoring.h
new file mode 100644
index 00000000..23c3c514
--- /dev/null
+++ b/APEX_1.4/shared/external/include/ClothingAuthoring.h
@@ -0,0 +1,1884 @@
+/*
+ * Copyright (c) 2008-2015, NVIDIA CORPORATION.  All rights reserved.
+ *
+ * NVIDIA CORPORATION and its licensors retain all intellectual property
+ * and proprietary rights in and to this software, related documentation
+ * and any modifications thereto.  Any use, reproduction, disclosure or
+ * distribution of this software and related documentation without an express
+ * license agreement from NVIDIA CORPORATION is strictly prohibited.
+ */
+
+#ifndef CLOTHING_AUTHORING_H
+#define CLOTHING_AUTHORING_H
+
+#include "PxPreprocessor.h"
+#if PX_WINDOWS_FAMILY
+
+#include "ApexDefs.h"
+
+#include "PxMath.h"
+#include "PxMat33.h"
+#include "PxMat44.h"
+#include "PxCpuDispatcher.h"
+#include <nvparameterized/NvSerializer.h>
+
+#include <IProgressListener.h>
+#include <UserRenderResourceManager.h>
+#include <UserRenderVertexBufferDesc.h>
+#include <nvparameterized/NvParameterized.h>
+
+#include <clothing/ClothingAsset.h>
+
+#include <AutoGeometry.h>
+
+#include <vector>
+#include <map>
+
+
+namespace physx
+{
+class PxScene;
+class PxMaterial;
+class PxRigidStatic;
+
+namespace pvdsdk
+{
+	class PxPvd;
+}
+
+class PxCpuDispatcher;
+}
+
+namespace nvidia
+{
+namespace apex
+{
+class ApexSDK;
+class RenderDebugInterface;
+class Renderable;
+class Scene;
+class ResourceCallback;
+class UserRenderResourceManager;
+
+class RenderMeshAssetAuthoring;
+
+class ModuleClothing;
+class ClothingActor;
+class ClothingAsset;
+class ClothingAssetAuthoring;
+class ClothingPhysicalMesh;
+class ClothingPreview;
+class ClothingUserRecompute;
+class ClothingPlane;
+struct ClothingMeshSkinningMap;
+}
+}
+
+
+namespace Samples
+{
+class MaterialList;
+class TriangleMesh;
+class SkeletalAnim;
+}
+
+
+
+namespace SharedTools
+{
+
+class MeshPainter;
+
+class ClothingAuthoring
+{
+public:
+
+	class ErrorCallback
+	{
+	public:
+		void reportErrorPrintf(const char* label, const char* fmt, ...);
+		virtual void reportError(const char* label, const char* message) = 0;
+	};
+
+	class NotificationCallback
+	{
+	public:
+		virtual void notifyRestart() = 0;
+		virtual void notifyInputMeshLoaded() = 0;
+		virtual void notifyMeshPos(const physx::PxVec3&) = 0;
+	};
+
+
+
+	struct BrushMode
+	{
+		enum Enum
+		{
+			PaintFlat,
+			PaintVolumetric,
+			Smooth,
+		};
+	};
+
+
+
+	struct CollisionVolume
+	{
+		CollisionVolume() : boneIndex(-1), parentIndex(-1), transform(physx::PxIdentity), meshVolume(0.0f),
+			capsuleHeight(0.0f), capsuleRadius(0.0f), shapeOffset(physx::PxIdentity), inflation(0.0f) {}
+
+		void draw(nvidia::apex::RenderDebugInterface* batcher, Samples::SkeletalAnim* anim, bool wireframe, float simulationScale);
+
+		int							boneIndex;
+		int							parentIndex;
+		std::string					boneName;
+		physx::PxTransform			transform;
+		std::vector<physx::PxVec3>	vertices;
+		std::vector<uint32_t>		indices;
+		float						meshVolume;
+		float						capsuleHeight;
+		float						capsuleRadius;
+		physx::PxTransform			shapeOffset;
+		float						inflation;
+	};
+
+
+
+	ClothingAuthoring(
+	    nvidia::apex::ApexSDK* apexSDK,
+	    nvidia::apex::ModuleClothing* moduleClothing,
+	    nvidia::apex::ResourceCallback* resourceCallback,
+	    nvidia::apex::UserRenderResourceManager* renderResourceManager,
+	    ClothingAuthoring::ErrorCallback* errorCallback,
+		nvidia::PxPvd* pvd = NULL,
+		nvidia::apex::RenderDebugInterface* renderDebug = NULL
+		);
+
+	virtual ~ClothingAuthoring();
+
+	void addNotifyCallback(NotificationCallback* callback);
+	void setMaterialList(Samples::MaterialList* list);
+
+	void releasePhysX();
+	void connectPVD(bool toggle);
+
+	int  getNumParameters() const;
+	bool getParameter(unsigned int i, std::string& name, std::string& type, std::string& val) const;
+	bool setParameter(std::string& name, std::string& type, std::string& val);
+
+
+	// state information
+
+	bool  getAndClearNeedsRedraw()
+	{
+		bool temp = mState.needsRedraw;
+		mState.needsRedraw = false;
+		return temp;
+	}
+
+	bool  getAndClearNeedsRestart()
+	{
+		bool temp = mState.needsRestart;
+		mState.needsRestart = false;
+		return temp;
+	}
+
+	bool  getAndClearManualAnimation()
+	{
+		bool temp = mState.manualAnimation;
+		mState.manualAnimation = false;
+		return temp;
+	}
+	void  setManualAnimation(bool on)
+	{
+		mState.manualAnimation = on;
+	}
+
+	struct AuthoringState
+	{
+		enum Enum
+		{
+			None = 0,
+			MeshLoaded,
+			SubmeshSelectionChanged,
+			PaintingChanged,
+			RenderMeshAssetCreated,
+			PhysicalCustomMeshCreated,
+			PhysicalClothMeshCreated,
+			ClothingAssetCreated,
+		};
+	};
+
+	AuthoringState::Enum getAuthoringState() const
+	{
+		return mState.authoringState;
+	}
+
+	bool createDefaultMaterialLibrary();
+	bool addMaterialLibrary(const char* name, NvParameterized::Interface* newInterface);
+	void removeMaterialLibrary(const char* name);
+
+	void addMaterialToLibrary(const char* libName, const char* matName);
+	void removeMaterialFromLibrary(const char* libName, const char* matName);
+
+	void selectMaterial(const char* libName, const char* matName);
+	void clearMaterialLibraries();
+
+	const char* getSelectedMaterialLibrary() const
+	{
+		return mState.selectedMaterialLibrary.c_str();
+	}
+	const char* getSelectedMaterial() const
+	{
+		return mState.selectedMaterial.c_str();
+	}
+
+	physx::PxBounds3 getSimulationBounds() const
+	{
+		return mState.apexBounds;
+	}
+
+	physx::PxBounds3 getCombinedSimulationBounds() const;
+
+	size_t getNumMaterialLibraries() const
+	{
+		return mState.materialLibraries.size();
+	}
+	NvParameterized::Interface* getMaterialLibrary(unsigned int libraryIndex) const;
+	bool setMaterialLibrary(unsigned int libraryIndex, NvParameterized::Interface* data);
+	const char* getMaterialLibraryName(unsigned int libraryIndex) const;
+	unsigned int getNumMaterials(unsigned int libraryIndex) const;
+	const char* getMaterialName(unsigned int libraryIndex, unsigned int materialIndex) const;
+
+	float getDrawWindTime() const
+	{
+		return mState.drawWindTime;
+	}
+	const physx::PxVec3& getWindOrigin() const
+	{
+		return mState.windOrigin;
+	}
+	const physx::PxVec3& getWindTarget() const
+	{
+		return mState.windTarget;
+	}
+
+	// dirty information
+
+	void  setMaxDistancePaintingDirty(bool dirty)
+	{
+		mDirty.maxDistancePainting |= dirty;
+	}
+	bool  getAndClearMaxDistancePaintingDirty()
+	{
+		bool temp = mDirty.maxDistancePainting;
+		mDirty.maxDistancePainting = false;
+		return temp;
+	}
+
+	bool  getAndClearGroundPlaneDirty()
+	{
+		bool temp = mDirty.groundPlane;
+		mDirty.groundPlane = false;
+		return temp;
+	}
+
+	bool  getAndClearGravityDirty()
+	{
+		bool temp = mDirty.gravity;
+		mDirty.gravity = false;
+		return temp;
+	}
+
+	bool  getAndClearWorkspaceDirty()
+	{
+		bool temp = mDirty.workspace;
+		mDirty.workspace = false;
+		return temp;
+	}
+
+	void  setSimulationValueScale(float v)
+	{
+		mState.simulationValuesScale = v;
+	}
+	float getSimulationValueScale() const
+	{
+		return mState.simulationValuesScale;
+	}
+
+	void  setGravityValueScale(float v)
+	{
+		mState.gravityValueScale = v;
+	}
+	float getGravityValueScale() const
+	{
+		return mState.gravityValueScale;
+	}
+
+
+
+	// simulation objects
+	size_t getNumSimulationAssets() const
+	{
+		return mSimulation.assets.size();
+	}
+	size_t getNumTriangleMeshes() const
+	{
+		return mSimulation.actors.size();
+	}
+	Samples::TriangleMesh* getTriangleMesh(size_t index)
+	{
+		return mSimulation.actors[index].triangleMesh;
+	}
+	const physx::PxMat44& getTriangleMeshPose(size_t index) const;
+
+	size_t getNumActors() const
+	{
+		return mSimulation.actors.size() * mSimulation.assets.size();
+	}
+
+	size_t getNumSimulationActors() const;
+	nvidia::apex::ClothingActor* getSimulationActor(size_t index);
+	nvidia::apex::Renderable* getSimulationRenderable(size_t index);
+
+	void initMeshSkinningData();
+	nvidia::apex::ClothingMeshSkinningMap* getMeshSkinningMap(size_t index, uint32_t lod, uint32_t& mapSize, nvidia::apex::RenderMeshAsset*& renderMeshAsset);
+
+	void  setActorCount(int count, bool addToCommandQueue);
+	int   getActorCount() const
+	{
+		return mSimulation.actorCount;
+	}
+	float getActorScale(size_t index);
+
+	void  setMatrices(const physx::PxMat44& viewMatrix, const physx::PxMat44& projectionMatrix);
+
+	void  startCreateApexScene();
+	bool  addAssetToScene(nvidia::apex::ClothingAsset* asset, nvidia::apex::IProgressListener* progress, unsigned int totalNumAssets = 1);
+	void  handleGravity();
+	void  finishCreateApexScene(bool recomputeScale);
+
+	void  startSimulation();
+	void  stopSimulation();
+	void  restartSimulation();
+	bool  updateCCT(float deltaT);
+
+	void  stepsUntilPause(int steps);
+	unsigned int getFrameNumber() const
+	{
+		return mSimulation.frameNumber;
+	}
+	int   getMaxLodValue() const;
+	nvidia::apex::Scene* getApexScene() const
+	{
+		return mSimulation.apexScene;
+	}
+#if PX_PHYSICS_VERSION_MAJOR == 3
+	physx::PxScene* getPhysXScene() const
+	{
+		return mSimulation.physxScene;
+	}
+#endif
+	bool  isPaused() const
+	{
+		return mSimulation.paused;
+	}
+
+
+
+	// Meshes
+	bool loadInputMesh(const char* filename, bool allowConversion, bool silentOnError, bool recurseIntoApx);
+	bool loadAnimation(const char* filename, std::string& error);
+	NvParameterized::Interface* extractRMA(NvParameterized::Handle& param);
+	bool saveInputMeshToXml(const char* filename);
+	bool saveInputMeshToEzm(const char* filename);
+	void setInputMeshFilename(const char* filename)
+	{
+		mDirty.workspace |= mMeshes.inputMeshFilename.compare(filename) != 0;
+		mMeshes.inputMeshFilename = filename;
+	}
+	const char* getInputMeshFilename() const
+	{
+		return mMeshes.inputMeshFilename.c_str();
+	}
+	void selectSubMesh(int subMeshNr, bool on);
+	bool hasTangentSpaceGenerated()
+	{
+		return mMeshes.tangentSpaceGenerated;
+	}
+
+	bool loadCustomPhysicsMesh(const char* filename);
+	const char* getCustomPhysicsMeshFilename() const
+	{
+		return mMeshes.customPhysicsMeshFilename.empty() ? NULL : mMeshes.customPhysicsMeshFilename.c_str();
+	}
+	void clearCustomPhysicsMesh();
+
+	Samples::TriangleMesh* getInputMesh()
+	{
+		return mMeshes.inputMesh;
+	}
+	Samples::SkeletalAnim* getSkeleton()
+	{
+		return mMeshes.skeleton;
+	}
+	Samples::TriangleMesh* getCustomPhysicsMesh()
+	{
+		return mMeshes.customPhysicsMesh;
+	}
+	Samples::TriangleMesh* getGroundMesh()
+	{
+		PX_ASSERT(mMeshes.groundMesh);
+		return mMeshes.groundMesh;
+	}
+
+	// modify mesh
+	int subdivideSubmesh(int subMeshNumber);
+	size_t getNumSubdivisions()
+	{
+		return mMeshes.subdivideHistory.size();
+	}
+	int getSubdivisionSubmesh(int index)
+	{
+		return mMeshes.subdivideHistory[(uint32_t)index].submesh;
+	}
+	int getSubdivisionSize(int index)
+	{
+		return mMeshes.subdivideHistory[(uint32_t)index].subdivision;
+	}
+
+	void renameSubMeshMaterial(size_t submesh, const char* newName);
+	void generateInputTangentSpace();
+
+	// painting
+	MeshPainter* getPainter()
+	{
+		return mMeshes.painter;
+	}
+	void paint(const physx::PxVec3& rayOrigin, const physx::PxVec3& rayDirection, bool execute, bool leftButton, bool rightButton);
+	void floodPainting(bool invalid);
+	void smoothPainting(int numIterations);
+
+	void updatePainter();
+	void setPainterIndexBufferRange();
+	void updatePaintingColors();
+	bool getMaxDistancePaintValues(const float*& values, int& numValues, int& byteStride);
+	float getAbsolutePaintingScalingMaxDistance();
+	float getAbsolutePaintingScalingCollisionFactor();
+
+	void initGroundMesh(const char* resourceDir);
+
+	// modify animation
+	void setAnimationPose(int position);
+	void setBindPose();
+	void setAnimationTime(float t);
+	float getAnimationTime() const;
+	bool updateAnimation();
+	void skinMeshes(Samples::SkeletalAnim* anim);
+
+	// collision volumes
+	void clearCollisionVolumes();
+	unsigned int generateCollisionVolumes(bool useCapsule, bool commandMode, bool dirtyOnly);
+	CollisionVolume* addCollisionVolume(bool useCapsule, unsigned int boneIndex, bool createFromMesh);
+	size_t getNumCollisionVolumes() const
+	{
+		return mMeshes.collisionVolumes.size();
+	}
+	CollisionVolume* getCollisionVolume(int index);
+	bool deleteCollisionVolume(int index);
+	void drawCollisionVolumes(bool wireframe) const;
+
+	// Authoring objecst
+	size_t getNumRenderMeshAssets()
+	{
+		return (uint32_t)mConfig.cloth.numGraphicalLods;
+	}
+	nvidia::apex::RenderMeshAssetAuthoring* getRenderMeshAsset(int index);
+
+	nvidia::apex::ClothingPhysicalMesh* getClothMesh(int index, nvidia::apex::IProgressListener* progress);
+	void simplifyClothMesh(float factor);
+	int getNumClothTriangles() const;
+
+	nvidia::apex::ClothingPhysicalMesh* getPhysicalMesh();
+	nvidia::apex::ClothingAssetAuthoring* getClothingAsset(nvidia::apex::IProgressListener* progress);
+
+	// configuration.UI
+	void  setZAxisUp(bool z);
+	bool  getZAxisUp() const
+	{
+		return mConfig.ui.zAxisUp;
+	}
+
+	void setSpotLight(bool s)
+	{
+		mDirty.workspace |= mConfig.ui.spotLight != s;
+		mConfig.ui.spotLight = s;
+	}
+	bool getSpotLight() const
+	{
+		return mConfig.ui.spotLight;
+	}
+
+	void setSpotLightShadow(bool s)
+	{
+		mDirty.workspace |= mConfig.ui.spotLightShadow != s;
+		mConfig.ui.spotLightShadow = s;
+	}
+	bool getSpotLightShadow() const
+	{
+		return mConfig.ui.spotLightShadow;
+	}
+
+	// configuration.mesh
+	void  setSubmeshSubdiv(int value)
+	{
+		mDirty.workspace |= mConfig.mesh.originalMeshSubdivision != value;
+		mConfig.mesh.originalMeshSubdivision = value;
+	}
+	int   getSubmeshSubdiv() const
+	{
+		return mConfig.mesh.originalMeshSubdivision;
+	}
+
+	void  setEvenOutVertexDegrees(bool on)
+	{
+		mDirty.workspace |= mConfig.mesh.evenOutVertexDegrees != on;
+		mConfig.mesh.evenOutVertexDegrees = on;
+	}
+	bool  getEvenOutVertexDegrees() const
+	{
+		return mConfig.mesh.evenOutVertexDegrees;
+	}
+
+	void  setCullMode(nvidia::apex::RenderCullMode::Enum mode);
+	nvidia::apex::RenderCullMode::Enum getCullMode() const
+	{
+		return (nvidia::apex::RenderCullMode::Enum)mConfig.mesh.cullMode;
+	}
+
+	void  setTextureUvOrigin(nvidia::apex::TextureUVOrigin::Enum origin);
+	nvidia::apex::TextureUVOrigin::Enum getTextureUvOrigin() const
+	{
+		return (nvidia::apex::TextureUVOrigin::Enum)mConfig.mesh.textureUvOrigin;
+	}
+
+	// configuration.Apex
+	void  setParallelCpuSkinning(bool s)
+	{
+		mDirty.workspace |= mConfig.apex.parallelCpuSkinning != s;
+		mConfig.apex.parallelCpuSkinning = s;
+		mDirty.clothingActorFlags = true;
+	}
+	bool  getParallelCpuSkinning() const
+	{
+		return mConfig.apex.parallelCpuSkinning;
+	}
+
+	void  setRecomputeNormals(bool r)
+	{
+		mDirty.workspace |= mConfig.apex.recomputeNormals != r;
+		mConfig.apex.recomputeNormals = r;
+		mDirty.clothingActorFlags = true;
+	}
+	bool  getRecomputeNormals() const
+	{
+		return mConfig.apex.recomputeNormals;
+	}
+
+	void  setRecomputeTangents(bool r)
+	{
+		mDirty.workspace |= mConfig.apex.recomputeTangents != r;
+		mConfig.apex.recomputeTangents = r;
+		mDirty.clothingActorFlags = true;
+	}
+	bool  getRecomputeTangents() const
+	{
+		return mConfig.apex.recomputeTangents;
+	}
+
+	void  setCorrectSimulationNormals(bool c)
+	{
+		mConfig.apex.correctSimulationNormals = c;
+		mDirty.clothingActorFlags = true;
+	}
+	bool  getCorrectSimulationNormals() const
+	{
+		return mConfig.apex.correctSimulationNormals;
+	}
+
+	void  setUseMorphTargets(bool on)
+	{
+		mState.needsRestart |= mConfig.apex.useMorphTargetTest != on;
+		mConfig.apex.useMorphTargetTest = on;
+	}
+	bool  getUseMorphTargets() const
+	{
+		return mConfig.apex.useMorphTargetTest;
+	}
+
+	void setForceEmbedded(bool on)
+	{
+		mDirty.workspace |= mConfig.apex.forceEmbedded != on;
+		mConfig.apex.forceEmbedded = on;
+		mState.needsRestart = true;
+	}
+	bool getForceEmbedded()
+	{
+		return mConfig.apex.forceEmbedded;
+	}
+
+	// configuration.tempMeshes.Cloth
+	void  setClothNumGraphicalLods(int numLods)
+	{
+		mDirty.workspace |= mConfig.cloth.numGraphicalLods != numLods;
+		mConfig.cloth.numGraphicalLods = numLods;
+		setAuthoringState(AuthoringState::RenderMeshAssetCreated, false);
+	}
+	int   getClothNumGraphicalLods() const
+	{
+		return mConfig.cloth.numGraphicalLods;
+	}
+
+	void  setClothSimplifySL(int simplification)
+	{
+		mDirty.workspace |= mConfig.cloth.simplify != simplification;
+		mConfig.cloth.simplify = simplification;
+		setAuthoringState(AuthoringState::RenderMeshAssetCreated, false);
+	}
+	int   getClothSimplifySL() const
+	{
+		return mConfig.cloth.simplify;
+	}
+
+	void  setCloseCloth(bool close)
+	{
+		mDirty.workspace |= mConfig.cloth.close != close;
+		mConfig.cloth.close = close;
+		setAuthoringState(AuthoringState::RenderMeshAssetCreated, false);
+	}
+	bool  getCloseCloth() const
+	{
+		return mConfig.cloth.close;
+	}
+
+	void  setSlSubdivideCloth(bool subdivide)
+	{
+		mDirty.workspace |= mConfig.cloth.subdivide != subdivide;
+		mConfig.cloth.subdivide = subdivide;
+		setAuthoringState(AuthoringState::RenderMeshAssetCreated, false);
+	}
+	bool  getSlSubdivideCloth() const
+	{
+		return mConfig.cloth.subdivide;
+	}
+
+	void  setClothMeshSubdiv(int subdivision)
+	{
+		mDirty.workspace |= mConfig.cloth.subdivision != subdivision;
+		mConfig.cloth.subdivision = subdivision;
+		setAuthoringState(AuthoringState::RenderMeshAssetCreated, false);
+	}
+	int   getClothMeshSubdiv() const
+	{
+		return mConfig.cloth.subdivision;
+	}
+
+	// configuration.collisionVolumes
+	void  setCollisionVolumeUsePaintChannel(bool on)
+	{
+		mDirty.workspace |= mConfig.collisionVolumes.usePaintingChannel != on;
+		mConfig.collisionVolumes.usePaintingChannel = on;
+	}
+	bool  getCollisionVolumeUsePaintChannel() const
+	{
+		return mConfig.collisionVolumes.usePaintingChannel;
+	}
+
+
+
+	// configuration.painting
+	void  setBrushMode(BrushMode::Enum mode)
+	{
+		mDirty.workspace |= mConfig.painting.brushMode != mode;
+		mConfig.painting.brushMode = mode;
+	}
+	BrushMode::Enum getBrushMode() const
+	{
+		return (BrushMode::Enum)mConfig.painting.brushMode;
+	}
+
+	void  setFalloffExponent(float exp)
+	{
+		mDirty.workspace |= mConfig.painting.falloffExponent != exp;
+		mConfig.painting.falloffExponent = exp;
+		mState.needsRedraw = true;
+	}
+	float getFalloffExponent() const
+	{
+		return mConfig.painting.falloffExponent;
+	}
+
+	void  setPaintingChannel(int channel);
+	int getPaintingChannel() const
+	{
+		return mConfig.painting.channel;
+	}
+
+	void  setPaintingValue(float val, float vmin, float vmax);
+	float getPaintingValue() const
+	{
+		return mConfig.painting.value;
+	}
+	float getPaintingValueMin() const
+	{
+		return mConfig.painting.valueMin;
+	}
+	float getPaintingValueMax() const
+	{
+		return mConfig.painting.valueMax;
+	}
+
+	void setPaintingValueFlag(unsigned int flags);
+	unsigned int getPaintingValueFlag() const
+	{
+		return (uint32_t)mConfig.painting.valueFlag;
+	}
+
+	void  setBrushRadius(int radius)
+	{
+		mDirty.workspace |= mConfig.painting.brushRadius != radius;
+		mConfig.painting.brushRadius = radius;
+	}
+	int   getBrushRadius() const
+	{
+		return mConfig.painting.brushRadius;
+	}
+
+	void  setPaintingScalingMaxDistance(float scaling)
+	{
+		mDirty.workspace |= mConfig.painting.scalingMaxdistance != scaling;
+		mConfig.painting.scalingMaxdistance = scaling;
+		mDirty.maxDistancePainting = true;
+		mDirty.clothingActorFlags = true;
+		setAuthoringState(AuthoringState::PaintingChanged, false);
+	}
+	float getPaintingScalingMaxDistance() const
+	{
+		return mConfig.painting.scalingMaxdistance;
+	}
+
+	void  setPaintingScalingCollisionFactor(float scaling)
+	{
+		mDirty.workspace |= mConfig.painting.scalingCollisionFactor != scaling;
+		mConfig.painting.scalingCollisionFactor = scaling;
+		mDirty.clothingActorFlags = true;
+		setAuthoringState(AuthoringState::PaintingChanged, false);
+	}
+	float getPaintingScalingCollisionFactor() const
+	{
+		return mConfig.painting.scalingCollisionFactor;
+	}
+
+	void  setMaxDistanceScale(float scale)
+	{
+		mDirty.maxDistanceScale |= mConfig.painting.maxDistanceScale != scale;
+		mConfig.painting.maxDistanceScale = scale;
+	}
+	float getMaxDistanceScale() const
+	{
+		return mConfig.painting.maxDistanceScale;
+	}
+
+	void  setMaxDistanceScaleMultipliable(bool multipliable)
+	{
+		mDirty.maxDistanceScale |= mConfig.painting.maxDistanceScaleMultipliable != multipliable;
+		mConfig.painting.maxDistanceScaleMultipliable = multipliable;
+	}
+	bool  getMaxDistanceScaleMultipliable() const
+	{
+		return mConfig.painting.maxDistanceScaleMultipliable;
+	}
+
+	// configuration.setMeshes
+	void  setDeriveNormalsFromBones(bool on)
+	{
+		mDirty.workspace |= mConfig.setMeshes.deriveNormalsFromBones != on;
+		mConfig.setMeshes.deriveNormalsFromBones = on;
+	}
+	bool  getDeriveNormalsFromBones() const
+	{
+		return mConfig.setMeshes.deriveNormalsFromBones;
+	}
+
+	// configuration.simulation
+	void  setSimulationFrequency(int freq)
+	{
+		mDirty.workspace |= mConfig.simulation.frequency != (float)freq;
+		mConfig.simulation.frequency = (float)freq;
+	}
+	int   getSimulationFrequency() const
+	{
+		return (int)mConfig.simulation.frequency;
+	}
+
+	void  setGravity(int gravity)
+	{
+		mDirty.workspace |= mConfig.simulation.gravity != gravity;
+		mConfig.simulation.gravity = gravity;
+		mDirty.gravity = true;
+	}
+	int   getGravity() const
+	{
+		return mConfig.simulation.gravity;
+	}
+
+	void  setGroundplane(int v)
+	{
+		mDirty.workspace |= mConfig.simulation.groundplane != v;
+		mConfig.simulation.groundplane = v;
+		mDirty.groundPlane = true;
+	}
+	int   getGroundplane() const
+	{
+		return mConfig.simulation.groundplane;
+	}
+
+	void  setGroundplaneEnabled(bool on)
+	{
+		mDirty.workspace |= mConfig.simulation.groundplaneEnabled != on;
+		mConfig.simulation.groundplaneEnabled = on;
+		mDirty.groundPlane = true;
+	}
+	bool  getGroundplaneEnabled() const
+	{
+		return mConfig.simulation.groundplaneEnabled;
+	}
+
+	void  setBudgetPercent(int p)
+	{
+		p = physx::PxClamp(p, 0, 100);
+		mConfig.simulation.budgetPercent = p;
+	}
+	int   getBudgetPercent() const
+	{
+		return mConfig.simulation.budgetPercent;
+	}
+
+	void  setInterCollisionDistance(float distance)
+	{
+		mDirty.workspace |= mConfig.simulation.interCollisionDistance != distance;
+		mConfig.simulation.interCollisionDistance = distance;
+	}
+	float getInterCollisionDistance() const
+	{
+		return mConfig.simulation.interCollisionDistance;
+	}
+
+	void  setInterCollisionStiffness(float stiffness)
+	{
+		mDirty.workspace |= mConfig.simulation.interCollisionStiffness != stiffness;
+		mConfig.simulation.interCollisionStiffness = stiffness;
+	}
+	float getInterCollisionStiffness() const
+	{
+		return mConfig.simulation.interCollisionStiffness;
+	}
+
+	void  setInterCollisionIterations(int iterations)
+	{
+		mDirty.workspace |= mConfig.simulation.interCollisionIterations != iterations;
+		mConfig.simulation.interCollisionIterations = iterations;
+	}
+	int getInterCollisionIterations() const
+	{
+		return mConfig.simulation.interCollisionIterations;
+	}
+
+	void  setBlendTime(float time)
+	{
+		mDirty.workspace |= mConfig.simulation.blendTime != time;
+		mConfig.simulation.blendTime = time;
+		mDirty.blendTime = true;
+	}
+	float getBlendTime() const
+	{
+		return mConfig.simulation.blendTime;
+	}
+
+	void  setPressure(float p)
+	{
+		mDirty.workspace |= mConfig.simulation.pressure != p;
+		mConfig.simulation.pressure = p;
+		mDirty.pressure = true;
+	}
+	float getPressure() const
+	{
+		return mConfig.simulation.pressure;
+	}
+
+	void  setLodOverwrite(int lod)
+	{
+		mDirty.workspace |= mConfig.simulation.lodOverwrite != lod;
+		mConfig.simulation.lodOverwrite = lod;
+	}
+	int   getLodOverwrite() const
+	{
+		return mConfig.simulation.lodOverwrite;
+	}
+
+	void  setWindDirection(int w)
+	{
+		mDirty.workspace |= mConfig.simulation.windDirection != w;
+		mConfig.simulation.windDirection = w;
+		mState.drawWindTime = 3.0f;
+	}
+	int   getWindDirection() const
+	{
+		return mConfig.simulation.windDirection;
+	}
+
+	void  setWindElevation(int w)
+	{
+		mDirty.workspace |= mConfig.simulation.windElevation != w;
+		mConfig.simulation.windElevation = w;
+		mState.drawWindTime = 3.0f;
+	}
+	int   getWindElevation() const
+	{
+		return mConfig.simulation.windElevation;
+	}
+
+	void  setWindVelocity(int w)
+	{
+		mDirty.workspace |= mConfig.simulation.windVelocity != w;
+		mConfig.simulation.windVelocity = w;
+		mState.drawWindTime = 3.0f;
+	}
+	int   getWindVelocity() const
+	{
+		return mConfig.simulation.windVelocity;
+	}
+
+	void  setGpuSimulation(bool gpuSimulation)
+	{
+		mDirty.workspace |= mConfig.simulation.gpuSimulation != gpuSimulation;
+		mConfig.simulation.gpuSimulation = gpuSimulation;
+		mState.needsRestart = true;
+	}
+	bool  getGpuSimulation() const
+	{
+		return mConfig.simulation.gpuSimulation;
+	}
+
+	void  setMeshSkinningInApp(bool meshSkinningInApp)
+	{
+		mConfig.simulation.meshSkinningInApp = meshSkinningInApp;
+		mState.needsRestart = true;
+	}
+	bool  getMeshSkinningInApp() const
+	{
+		return mConfig.simulation.meshSkinningInApp;
+	}
+
+	void  setFallbackSkinning(bool fallbackSkinning)
+	{
+		mDirty.workspace |= mConfig.simulation.fallbackSkinning != fallbackSkinning;
+		mConfig.simulation.fallbackSkinning = fallbackSkinning;
+		mState.needsRestart = true;
+	}
+	bool  getFallbackSkinning() const
+	{
+		return mConfig.simulation.fallbackSkinning;
+	}
+
+	void  setCCTSpeed(float speed)
+	{
+		mConfig.simulation.CCTSpeed = speed;
+	}
+	float getCCTSpeed() const
+	{
+		return mConfig.simulation.CCTSpeed;
+	}
+
+	void  setTimingNoise(float noise)
+	{
+		mConfig.simulation.timingNoise = noise;
+	}
+	float getTimingNoise() const
+	{
+		return mConfig.simulation.timingNoise;
+	}
+
+	void  setScaleFactor(float factor)
+	{
+		mDirty.workspace |= mConfig.simulation.scaleFactor != factor;
+		mState.needsRestart |= mConfig.simulation.scaleFactor != factor;
+		mConfig.simulation.scaleFactor = factor;
+	}
+	float getScaleFactor() const
+	{
+		return mConfig.simulation.scaleFactor;
+	}
+
+	void  setPvdDebug(bool on)
+	{
+		mDirty.workspace |= mConfig.simulation.pvdDebug != on;
+		mState.needsReconnect |= mConfig.simulation.pvdProfile != on;
+		mConfig.simulation.pvdDebug = on;
+	}
+	bool  getPvdDebug() const
+	{
+		return mConfig.simulation.pvdDebug;
+	}
+
+	void  setPvdProfile(bool on)
+	{
+		mDirty.workspace |= mConfig.simulation.pvdProfile != on;
+		mState.needsReconnect |= mConfig.simulation.pvdProfile != on;
+		mConfig.simulation.pvdProfile = on;
+	}
+	bool  getPvdProfile() const
+	{
+		return mConfig.simulation.pvdProfile;
+	}
+
+	void  setPvdMemory(bool on)
+	{
+		mDirty.workspace |= mConfig.simulation.pvdMemory != on;
+		mState.needsReconnect |= mConfig.simulation.pvdMemory != on;
+		mConfig.simulation.pvdMemory = on;
+	}
+	bool  getPvdMemory() const
+	{
+		return mConfig.simulation.pvdMemory;
+	}
+
+	void  setCCTDirection(const physx::PxVec3& direction)
+	{
+		mSimulation.CCTDirection = direction;
+	}
+
+	void  setCCTRotation(const physx::PxVec3 rotation)
+	{
+		mSimulation.CCTRotationDelta = rotation;
+	}
+
+	void  setGraphicalLod(int lod)
+	{
+		mDirty.workspace |= mConfig.simulation.graphicalLod != lod;
+		mConfig.simulation.graphicalLod = lod;
+	}
+	int   getGraphicalLod() const
+	{
+		return mConfig.simulation.graphicalLod;
+	}
+
+	void  setUsePreview(bool on)
+	{
+		mState.needsRestart |= mSimulation.actors.size() > 0;
+		mConfig.simulation.usePreview = on;
+	}
+	bool  getUsePreview() const
+	{
+		return mConfig.simulation.usePreview;
+	}
+
+	void  setLocalSpaceSim(bool on)
+	{
+		mDirty.workspace |= mConfig.simulation.localSpaceSim != on;
+		mState.needsRestart |= mConfig.simulation.localSpaceSim != on;
+		mConfig.simulation.localSpaceSim = on;
+	}
+	bool getLocalSpaceSim() const
+	{
+		return mConfig.simulation.localSpaceSim;
+	}
+
+
+
+	// configuration.animation
+	void  setShowSkinnedPose(bool on)
+	{
+		mConfig.animation.showSkinnedPose = on;
+	}
+	bool  getShowSkinnedPose()
+	{
+		return mConfig.animation.showSkinnedPose;
+	}
+
+	void  setAnimation(int animation);
+	int   getAnimation() const
+	{
+		return mConfig.animation.selectedAnimation;
+	}
+
+	void  setAnimationSpeed(int s)
+	{
+		mDirty.workspace |= mConfig.animation.speed != s;
+		mConfig.animation.speed = s;
+	}
+	int   getAnimationSpeed() const
+	{
+		return mConfig.animation.speed;
+	}
+
+	void  setAnimationTimes(float val)
+	{
+		mConfig.animation.time = val;
+	}
+	float getAnimationTimes() const
+	{
+		return mConfig.animation.time;
+	}
+	void  stepAnimationTimes(float animStep);
+	bool  clampAnimation(float& time, bool stoppable, bool loop, float minTime, float maxTime);
+
+	void  setLoopAnimation(bool on)
+	{
+		mDirty.workspace |= mConfig.animation.loop != on;
+		mConfig.animation.loop = on;
+	}
+	bool  getLoopAnimation() const
+	{
+		return mConfig.animation.loop;
+	}
+
+	void  setLockRootbone(bool on)
+	{
+		mDirty.workspace |= mConfig.animation.lockRootbone != on;
+		mConfig.animation.lockRootbone = on;
+		mState.manualAnimation = true;
+	}
+	bool  getLockRootbone() const
+	{
+		return mConfig.animation.lockRootbone;
+	}
+
+	void  setAnimationContinuous(bool on)
+	{
+		mDirty.workspace |= mConfig.animation.continuous != on;
+		mConfig.animation.continuous = on;
+	}
+	bool  getAnimationContinuous() const
+	{
+		return mConfig.animation.continuous;
+	}
+
+	void  setUseGlobalPoseMatrices(bool on)
+	{
+		mDirty.workspace |= mConfig.animation.useGlobalPoseMatrices != on;
+		mState.needsRestart = mConfig.animation.useGlobalPoseMatrices != on;
+		mConfig.animation.useGlobalPoseMatrices = on;
+	}
+	bool  getUseGlobalPoseMatrices() const
+	{
+		return mConfig.animation.useGlobalPoseMatrices;
+	}
+
+	void  setApplyGlobalPoseInApp(bool on)
+	{
+		mDirty.workspace |= mConfig.animation.applyGlobalPoseInApp != on;
+		mState.needsRestart = mConfig.animation.applyGlobalPoseInApp != on;
+		mConfig.animation.applyGlobalPoseInApp = on;
+	}
+	bool  getApplyGlobalPoseInApp() const
+	{
+		return mConfig.animation.applyGlobalPoseInApp;
+	}
+
+	void  setAnimationCrop(float min, float max);
+
+
+
+
+	// configuration.deformable
+	void  setDeformableThickness(float value)
+	{
+		mDirty.workspace |= mConfig.deformable.thickness != value;
+		mConfig.deformable.thickness = value;
+		mConfig.deformable.drawThickness = true;
+	}
+	float getDeformableThickness() const
+	{
+		return mConfig.deformable.thickness;
+	}
+
+	void  setDrawDeformableThickness(bool on)
+	{
+		mConfig.deformable.drawThickness = on;
+	}
+	bool  getDrawDeformableThickness() const
+	{
+		return mConfig.deformable.drawThickness;
+	}
+
+	void setDeformableVirtualParticleDensity(float val)
+	{
+		mDirty.workspace |= mConfig.deformable.virtualParticleDensity != val;
+		mConfig.deformable.virtualParticleDensity = val;
+	}
+
+	float getDeformableVirtualParticleDensity() const
+	{
+		return mConfig.deformable.virtualParticleDensity;
+	}
+
+	void  setDeformableHierarchicalLevels(int value)
+	{
+		mDirty.workspace |= mConfig.deformable.hierarchicalLevels != value;
+		mConfig.deformable.hierarchicalLevels = value;
+	}
+	int   getDeformableHierarchicalLevels() const
+	{
+		return mConfig.deformable.hierarchicalLevels;
+	}
+
+	void  setDeformableDisableCCD(bool on)
+	{
+		mDirty.workspace |= mConfig.deformable.disableCCD != on;
+		mConfig.deformable.disableCCD = on;
+	}
+	bool  getDeformableDisableCCD() const
+	{
+		return mConfig.deformable.disableCCD;
+	}
+
+	void  setDeformableTwowayInteraction(bool on)
+	{
+		mDirty.workspace |= mConfig.deformable.twowayInteraction != on;
+		mConfig.deformable.twowayInteraction = on;
+	}
+	bool  getDeformableTwowayInteraction() const
+	{
+		return mConfig.deformable.twowayInteraction;
+	}
+
+	void  setDeformableUntangling(bool on)
+	{
+		mDirty.workspace |= mConfig.deformable.untangling != on;
+		mConfig.deformable.untangling = on;
+	}
+	bool  getDeformableUntangling() const
+	{
+		return mConfig.deformable.untangling;
+	}
+
+	void  setDeformableRestLengthScale(float scale)
+	{
+		mDirty.workspace |= mConfig.deformable.restLengthScale != scale;
+		mConfig.deformable.restLengthScale = scale;
+	}
+	float getDeformableRestLengthScale() const
+	{
+		return mConfig.deformable.restLengthScale;
+	}
+
+
+	// init configuration
+	void resetTempConfiguration();
+	void initConfiguration();
+	void prepareConfiguration();
+
+
+	size_t getNumCommands() const
+	{
+		return mRecordCommands.size();
+	}
+	int getCommandFrameNumber(size_t index) const
+	{
+		return mRecordCommands[index].frameNumber;
+	}
+	const char* getCommandString(size_t index) const
+	{
+		return mRecordCommands[index].command.c_str();
+	}
+	void addCommand(const char* command, int frameNumber = -2);
+	void clearCommands();
+
+	// file IO
+	bool loadParameterized(const char* filename, physx::PxFileBuf* filebuffer, NvParameterized::Serializer::DeserializedData& deserializedData, bool silent = false);
+	bool saveParameterized(const char* filename, physx::PxFileBuf* filebuffer, const NvParameterized::Interface** pInterfaces, unsigned int numInterfaces);
+
+	void clearLoadedActorDescs();
+
+protected:
+	std::vector<NvParameterized::Interface*> mLoadedActorDescs;
+	std::vector<float> mMaxTimesteps;
+	std::vector<int> mMaxIterations;
+	std::vector<int> mTimestepMethods;
+	std::vector<float> mDts;
+	std::vector<physx::PxVec3> mGravities;
+	unsigned int mCurrentActorDesc;
+
+private:
+	NvParameterized::Serializer::SerializeType extensionToType(const char* filename) const;
+	bool parameterizedError(NvParameterized::Serializer::ErrorType errorType, const char* filename);
+
+	void setAuthoringState(AuthoringState::Enum authoringState, bool allowAdvance);
+
+	// internal methods
+	HACD::AutoGeometry* createAutoGeometry();
+	void addCollisionVolumeInternal(HACD::SimpleHull* hull, bool useCapsule);
+
+	void createRenderMeshAssets();
+	void createCustomMesh();
+	void createClothMeshes(nvidia::apex::IProgressListener* progress);
+	void createClothingAsset(nvidia::apex::IProgressListener* progress);
+
+	void updateDeformableParameters();
+
+	struct CurrentState
+	{
+		bool  needsRedraw;
+		bool  needsRestart;
+		bool  needsReconnect;
+		bool  manualAnimation;
+		AuthoringState::Enum authoringState;
+		float simulationValuesScale;
+		float gravityValueScale;
+
+		typedef std::map<std::string, NvParameterized::Interface*> tMaterialLibraries;
+		tMaterialLibraries materialLibraries;
+
+		std::string selectedMaterialLibrary;
+		std::string selectedMaterial;
+
+		physx::PxVec3 windOrigin;
+		physx::PxVec3 windTarget;
+		float drawWindTime;
+
+		physx::PxBounds3 apexBounds;
+
+		int currentFrameNumber;
+
+		void init()
+		{
+			needsRedraw = false;
+			needsRestart = false;
+			needsReconnect = false;
+			manualAnimation = false;
+			authoringState = AuthoringState::None;
+			simulationValuesScale = 1.0f;
+			gravityValueScale = 0.0f;
+
+			for (tMaterialLibraries::iterator it = materialLibraries.begin(); it != materialLibraries.end(); ++it)
+			{
+				it->second->destroy();
+			}
+
+			materialLibraries.clear();
+
+			selectedMaterialLibrary.clear();
+			selectedMaterial.clear();
+
+			windOrigin = physx::PxVec3(0.0f);
+			windTarget = physx::PxVec3(0.0f);
+			drawWindTime = 0;
+
+			apexBounds.setEmpty();
+
+			currentFrameNumber = -1;
+		}
+	};
+	CurrentState mState;
+
+
+
+	struct DirtyFlags
+	{
+		bool maxDistancePainting;
+		bool maxDistanceScale;
+		bool clothingActorFlags;
+		bool groundPlane;
+		bool gravity;
+		bool blendTime;
+		bool pressure;
+		bool workspace;
+
+		void init()
+		{
+			maxDistancePainting = false;
+			maxDistanceScale = false;
+			clothingActorFlags = false;
+			groundPlane = false;
+			gravity = false;
+			blendTime = false;
+			pressure = false;
+			workspace = false;
+		}
+	};
+	DirtyFlags mDirty;
+
+
+
+	struct Simulation
+	{
+		struct ClothingActor
+		{
+			ClothingActor() : scale(1.0f), triangleMesh(NULL)
+			{
+				initPose = physx::PxMat44(physx::PxIdentity);
+				currentPose = physx::PxMat44(physx::PxIdentity);
+			}
+			physx::PxMat44 initPose;
+			physx::PxMat44 currentPose;
+			float scale;
+			Samples::TriangleMesh* triangleMesh;
+			std::vector<nvidia::apex::ClothingActor*> actors;
+			std::vector<nvidia::apex::ClothingPreview*> previews;
+			std::vector<nvidia::apex::ClothingPlane*> actorGroundPlanes;
+		};
+
+		physx::PxCpuDispatcher* cpuDispatcher;
+		nvidia::apex::Scene* apexScene;
+		nvidia::apex::AssetPreviewScene* previewScene;
+		physx::PxCudaContextManager* cudaContextManager;
+
+		physx::PxScene* physxScene;
+		physx::PxMaterial* physxMaterial;
+
+		bool running;
+
+		struct ClothingAsset
+		{
+			ClothingAsset(nvidia::apex::ClothingAsset* _apexAsset) : apexAsset(_apexAsset) {}
+			void releaseRenderMeshAssets();
+
+			nvidia::apex::ClothingAsset* apexAsset;
+			std::vector<short> remapToSkeleton;
+			std::vector<std::vector<nvidia::apex::ClothingMeshSkinningMap> > meshSkinningMaps;
+			std::vector<nvidia::apex::RenderMeshAsset*> renderMeshAssets;
+		};
+
+		std::vector<ClothingAsset> assets;
+		bool clearAssets;
+		int actorCount;
+		std::vector<ClothingActor> actors;
+		bool paused;
+
+		physx::PxRigidStatic* groundPlane;
+
+		unsigned int stepsUntilPause;
+		unsigned int frameNumber;
+
+		physx::PxMat44 CCTPose;
+		physx::PxVec3 CCTDirection;
+		physx::PxVec3 CCTRotationDelta;
+
+
+		void init()
+		{
+			cpuDispatcher = NULL;
+			apexScene = NULL;
+			cudaContextManager = NULL;
+			physxScene = NULL;
+			physxMaterial = NULL;
+			groundPlane = NULL;
+			running = false;
+			clearAssets = true;
+			actorCount = 1;
+			paused = false;
+			stepsUntilPause = 0;
+			frameNumber = 0;
+
+			CCTPose = physx::PxMat44(physx::PxIdentity);
+			CCTDirection = physx::PxVec3(0.0f);
+			CCTRotationDelta = physx::PxVec3(0.0f);
+		}
+
+		void clear();
+	};
+	Simulation mSimulation;
+
+
+
+	struct Meshes
+	{
+		Samples::TriangleMesh*	inputMesh;
+		std::string				inputMeshFilename;
+		MeshPainter*			painter;
+
+		Samples::TriangleMesh*	customPhysicsMesh;
+		std::string				customPhysicsMeshFilename;
+
+		Samples::TriangleMesh*	groundMesh;
+
+		Samples::SkeletalAnim*	skeleton;
+		Samples::SkeletalAnim*	skeletonBehind;
+		std::vector<int>		skeletonRemap;
+
+		std::vector<CollisionVolume> collisionVolumes;
+
+		bool					tangentSpaceGenerated;
+
+		struct SubdivideHistoryItem
+		{
+			int submesh;
+			int subdivision;
+		};
+		std::vector<SubdivideHistoryItem> subdivideHistory;
+
+
+		struct SubmeshMaterialRename
+		{
+			int submesh;
+			std::string newName;
+		};
+
+		void init()
+		{
+			inputMesh			= NULL;
+			//inputMeshFilename.clear();
+			painter				= NULL;
+
+			customPhysicsMesh	= NULL;
+			customPhysicsMeshFilename.clear();
+			groundMesh			= NULL;
+
+			skeleton			= NULL;
+			skeletonBehind		= NULL;
+			skeletonRemap.clear();
+
+			collisionVolumes.clear();
+			subdivideHistory.clear();
+			tangentSpaceGenerated = false;
+		}
+
+		void clear(nvidia::apex::UserRenderResourceManager* rrm, nvidia::apex::ResourceCallback* rcb, bool groundAsWell);
+	};
+	Meshes mMeshes;
+
+
+
+	struct AuthoringObjects
+	{
+		std::vector<nvidia::apex::RenderMeshAssetAuthoring*> renderMeshAssets;
+		std::vector<nvidia::apex::ClothingPhysicalMesh*> physicalMeshes;
+		nvidia::apex::ClothingAssetAuthoring* clothingAssetAuthoring;
+
+		void init()
+		{
+			renderMeshAssets.clear();
+			physicalMeshes.clear();
+			clothingAssetAuthoring = NULL;
+		}
+
+		void clear();
+	};
+	AuthoringObjects mAuthoringObjects;
+
+	// configuration
+	std::map<std::string, float*> mFloatConfiguration;
+	std::map<std::string, float*> mFloatConfigurationOld;
+	std::map<std::string, int*> mIntConfiguration;
+	std::map<std::string, int*> mIntConfigurationOld;
+	std::map<std::string, bool*> mBoolConfiguration;
+	std::map<std::string, bool*> mBoolConfigurationOld;
+
+	struct configUI
+	{
+		bool zAxisUp;
+		bool spotLight;
+		bool spotLightShadow;
+
+		void init()
+		{
+			zAxisUp = false;
+			spotLight = false;
+			spotLightShadow = true;
+		}
+	};
+
+	struct configMesh
+	{
+		int		originalMeshSubdivision;
+		bool	evenOutVertexDegrees;
+		int		cullMode;
+		int		textureUvOrigin;
+		int     physicalMeshType;
+
+		void init()
+		{
+			originalMeshSubdivision = 10;
+			evenOutVertexDegrees = false;
+			cullMode = nvidia::apex::RenderCullMode::NONE;
+			textureUvOrigin = nvidia::apex::TextureUVOrigin::ORIGIN_TOP_LEFT;
+			physicalMeshType = 0;
+		}
+	};
+
+	struct configApex
+	{
+		bool	parallelCpuSkinning;
+		bool	recomputeNormals;
+		bool	recomputeTangents;
+		bool	correctSimulationNormals;
+		bool	useMorphTargetTest;
+		bool	forceEmbedded;
+
+		void init()
+		{
+			parallelCpuSkinning = true;
+			recomputeNormals = false;
+			recomputeTangents = false;
+			correctSimulationNormals = true;
+			useMorphTargetTest = false;
+			forceEmbedded = false;
+		}
+	};
+
+	struct configCloth
+	{
+		int		numGraphicalLods;
+		int		simplify;
+		bool	close;
+		bool	subdivide;
+		int		subdivision;
+
+		void init()
+		{
+			numGraphicalLods = 1;
+			simplify = 40;
+			close = false;
+			subdivide = false;
+			subdivision = 40;
+		}
+	};
+
+	struct configCollisionVolumes
+	{
+		bool	usePaintingChannel;
+
+		void init()
+		{
+			usePaintingChannel = false;
+		}
+	};
+
+	struct configPainting
+	{
+		int		brushMode;
+		float	falloffExponent;
+		int		channel;
+		float	value;
+		float	valueMin;
+		float	valueMax;
+		int		valueFlag;
+		int		brushRadius;
+		float	scalingMaxdistance;
+		float	scalingCollisionFactor;
+		float	maxDistanceScale;
+		bool	maxDistanceScaleMultipliable;
+
+		void init()
+		{
+			brushMode = BrushMode::PaintFlat;
+			falloffExponent = 1.0f;
+			channel = 4; // NUM_CHANNELS
+			value = 1.0f;
+			valueMin = 0.0f;
+			valueMax = 1.0f;
+			valueFlag = 1;
+			brushRadius = 50;
+			scalingMaxdistance = 1.0f;
+			scalingCollisionFactor = 1.0f;
+			maxDistanceScale = 1.0f;
+			maxDistanceScaleMultipliable = true;
+		}
+	};
+
+	struct configSetMeshes
+	{
+		bool	deriveNormalsFromBones;
+
+		void init()
+		{
+			deriveNormalsFromBones = false;
+		}
+	};
+
+	struct configSimulation
+	{
+		float	frequency;
+		int		gravity;
+		int		groundplane;
+		bool	groundplaneEnabled;
+		int		budgetPercent;
+		float	interCollisionDistance;
+		float	interCollisionStiffness;
+		int		interCollisionIterations;
+		float	blendTime;
+		float	pressure;
+		int		lodOverwrite;
+		int		windDirection;
+		int		windElevation;
+		int		windVelocity;
+		bool	gpuSimulation;
+		bool	meshSkinningInApp;
+		bool	fallbackSkinning;
+		float	CCTSpeed;
+		int		graphicalLod;
+		bool	usePreview;
+		float	timingNoise;
+		float	scaleFactor;
+		bool	localSpaceSim;
+
+		bool	pvdDebug;
+		bool	pvdProfile;
+		bool	pvdMemory;
+
+		void init()
+		{
+			frequency = 50.0f;
+			gravity = 10;
+			groundplane = 0;
+			groundplaneEnabled = true;
+			budgetPercent = 100;
+			interCollisionDistance = 0.1f;
+			interCollisionStiffness = 1.0f;
+			interCollisionIterations = 1;
+			blendTime = 1.0f;
+			pressure = -1.0f;
+			lodOverwrite = -1;
+			windDirection = 0;
+			windElevation = 0;
+			windVelocity = -1;
+			gpuSimulation = true;
+			meshSkinningInApp = false;
+			fallbackSkinning = false;
+			CCTSpeed = 0.0f;
+			graphicalLod = 0;
+			usePreview = false;
+			timingNoise = 0.0f;
+			scaleFactor = 1.0f;
+			localSpaceSim = true;
+
+			pvdDebug = true;
+			pvdProfile = true;
+			pvdMemory = false;
+		}
+	};
+
+	struct configAnimation
+	{
+		bool	showSkinnedPose; // can overwrite mAnimatio>0 for the non-simulating part
+		int		selectedAnimation; // 0 and negative mean no animation (use negative to switch off and remember which one)
+		int		speed;
+		float	time;
+		bool	loop;
+		bool	lockRootbone;
+		bool	continuous;
+		bool	useGlobalPoseMatrices;
+		bool	applyGlobalPoseInApp;
+
+		float   cropMin;
+		float   cropMax;
+
+		void init()
+		{
+			showSkinnedPose = false;
+			selectedAnimation = -1;
+			speed = 100;
+			time = 0.0f;
+			loop = true;
+			lockRootbone = false;
+			continuous = false;
+			useGlobalPoseMatrices = true;
+			applyGlobalPoseInApp = false;
+
+			cropMin = 0.0f;
+			cropMax = 1000000.0f;
+		}
+	};
+
+	struct configDeformable
+	{
+		float	thickness;
+		bool	drawThickness;
+		float	virtualParticleDensity;
+		int		hierarchicalLevels;
+		bool	disableCCD;
+		bool	twowayInteraction;
+		bool	untangling;
+		float	restLengthScale;
+
+		void init()
+		{
+			thickness = 0.01f;
+			drawThickness = false;
+			virtualParticleDensity = 0.0f;
+			hierarchicalLevels = 0;
+			disableCCD = false;
+			twowayInteraction = false;
+			untangling = false;
+			restLengthScale = 1.0f;
+		}
+	};
+
+	struct Configuration
+	{
+		configUI ui;
+		configMesh mesh;
+		configApex apex;
+		configCloth cloth;
+		configCollisionVolumes collisionVolumes;
+		configPainting painting;
+		configSetMeshes setMeshes;
+		configSimulation simulation;
+		configAnimation animation;
+		configDeformable deformable;
+
+		void init()
+		{
+			ui.init();
+			mesh.init();
+			apex.init();
+			cloth.init();
+			collisionVolumes.init();
+			painting.init();
+			setMeshes.init();
+			simulation.init();
+			animation.init();
+			deformable.init();
+		}
+	};
+
+	Configuration mConfig;
+
+	struct Command
+	{
+		int frameNumber;
+		std::string command;
+	};
+
+	std::vector<Command> mRecordCommands;
+
+
+protected:
+
+	// APEX
+	nvidia::apex::ApexSDK*			_mApexSDK;
+	nvidia::apex::ModuleClothing*		_mModuleClothing;
+
+	nvidia::apex::RenderDebugInterface*	_mApexRenderDebug;
+
+	nvidia::apex::ResourceCallback*	_mResourceCallback;
+
+	nvidia::apex::UserRenderResourceManager* _mRenderResourceManager;
+	Samples::MaterialList* _mMaterialList;
+
+	nvidia::PxPvd* mPvd;
+
+	// Callback
+	ErrorCallback* _mErrorCallback;
+
+	std::vector<NotificationCallback*> _mNotifyCallbacks;
+
+};
+
+} // namespace SharedTools
+
+#endif //PX_WINDOWS_FAMILY
+
+#endif //CLOTHING_AUTHORING_H
+
diff --git a/APEX_1.4/shared/external/include/DirEntry.h b/APEX_1.4/shared/external/include/DirEntry.h
new file mode 100644
index 00000000..c854e394
--- /dev/null
+++ b/APEX_1.4/shared/external/include/DirEntry.h
@@ -0,0 +1,29 @@
+/*
+ * Copyright (c) 2008-2015, NVIDIA CORPORATION.  All rights reserved.
+ *
+ * NVIDIA CORPORATION and its licensors retain all intellectual property
+ * and proprietary rights in and to this software, related documentation
+ * and any modifications thereto.  Any use, reproduction, disclosure or
+ * distribution of this software and related documentation without an express
+ * license agreement from NVIDIA CORPORATION is strictly prohibited.
+ */
+
+
+#ifndef DIR_ENTRY_INCLUDE_H
+#define DIR_ENTRY_INCLUDE_H
+
+#include "PxPreprocessor.h"
+
+#if PX_WINDOWS_FAMILY
+	#include "windows/DirEntry.h"
+#elif PX_XBOXONE
+	#include "xboxone/DirEntry.h"
+#elif (PX_LINUX_FAMILY || PX_APPLE_FAMILY || PX_ANDROID)
+	#include "linux/DirEntry.h"
+#elif PX_PS4
+	#include "ps4/DirEntry.h"
+#else
+	#error "Platform not supported!"
+#endif
+
+#endif // DIR_ENTRY_INCLUDE_H
diff --git a/APEX_1.4/shared/external/include/FilterBits.h b/APEX_1.4/shared/external/include/FilterBits.h
new file mode 100644
index 00000000..242d10ff
--- /dev/null
+++ b/APEX_1.4/shared/external/include/FilterBits.h
@@ -0,0 +1,147 @@
+/*
+ * Copyright (c) 2008-2015, NVIDIA CORPORATION.  All rights reserved.
+ *
+ * NVIDIA CORPORATION and its licensors retain all intellectual property
+ * and proprietary rights in and to this software, related documentation
+ * and any modifications thereto.  Any use, reproduction, disclosure or
+ * distribution of this software and related documentation without an express
+ * license agreement from NVIDIA CORPORATION is strictly prohibited.
+ */
+
+
+#ifndef FILTER_BITS_H
+
+#define FILTER_BITS_H
+
+// This class lets the user define an arbitrary set of 'types' or 'groups' up to 64 different kinds.
+// Each 'type' is assigned a bit position up to 64 bits total.
+//
+// The application can decide whether a null string should be treated as all bits are off, or all bits are on.
+//
+// This class organizes and builds everything as 64 bits, but has the option of returning only a 32 bit version
+// if that better matches the application requirements.
+//
+// Both the 64 bit and 32 bit representations are const pointers which are guaranteed to be persistent for the lifetime of the
+// parent object.  That way you can cache them in your own internal code.
+//
+// The purpose of this is so that artists/designers can express a set of 'groups/types' which interact with matching group
+// types without depending on a hard coded predefined set of options.
+//
+// Here are some examples:
+//
+// "player=terrain,building"
+//
+// In this example the user would be specifying that this is an object of type 'player' which interacts with types 'terrain and building'
+//
+// The pointer to the filterData bits are persistent and can be cached by the application.
+//
+// It's important to note that: "a,b,c=d,e,f"  will return the same result as "c,b,a=f,e,d"
+//
+// The following two strings are reserved: "none" and "all" where 'none' means all bits set to zero, and "all" means all bits set to one.
+
+#include "PxSimpleTypes.h"
+#include "ApexUsingNamespace.h"
+
+class FilterData
+{
+public:
+	FilterData(void)
+	{
+		w64.typeBits64 = 0;
+		w64.matchBits64 = 0;
+		typeString = 0;
+		for (uint32_t i=0; i<64; i++)
+		{
+			weights[i] = 1.0f;
+		}
+	}
+	union
+	{
+		struct 
+		{
+			uint64_t	typeBits64;		// The set of bits which describe what 'type' or 'group' this corresponds with
+			uint64_t	matchBits64;	// The set of bits describing which types or groups this object interacts with.
+		} w64;
+		struct 
+		{
+			uint32_t	word0;
+			uint32_t	word1;
+			uint32_t	word2;
+			uint32_t	word3;
+		} w32;
+	};
+	float		weights[64];	// filter data weights.
+	const char *typeString;	// the source string which produced this set of bits.
+};
+
+// The 128 bit encoding of the FilterData class
+class EncodedFilterData
+{
+public:
+	union
+	{
+		struct 
+		{
+			uint64_t	typeBits64;		// The set of bits which describe what 'type' or 'group' this corresponds with
+			uint64_t	matchBits64;	// The set of bits describing which types or groups this object interacts with.
+		} ew64;
+		struct 
+		{
+			uint32_t	word0;
+			uint32_t	word1;
+			uint32_t	word2;
+			uint32_t	word3;
+		} ew32;
+	};
+};
+
+class FilterBits
+{
+public:
+	// Returns the ASCII string equivalent of this set of FilterData flags
+	virtual const char *getFilterDataString(const FilterData &fd) const = 0;
+
+  	// Returns the combination of string of types based on this bit sequence.
+	virtual const char *getFilterString(uint64_t bits) const = 0;
+
+	// Returns the string for a single bit type 0-63
+	virtual const char *getTypeString(uint8_t type) const = 0; // single type 0-63
+
+	// Return the bit flag for a single group/type, the parameter 'index' will be assigned with it's array index.  If the type is 'all', then it will be set to 0xFFFFFFFF
+	virtual uint64_t getTypeBit(const char *str,uint32_t &index,bool &applyDefault) = 0;
+
+	// Returns how many types were defined.
+	virtual uint8_t getTypeCount(void) const = 0;
+
+	// Converts this ASCII string to it's corresponding binary bit representation with up to 64 bits worth of types.
+	virtual const FilterData *getFilterData(const char *str) = 0;
+
+	virtual const EncodedFilterData *getEncodedFilterData(const char *str) = 0;
+
+	// Encode it into 128 bits
+	virtual const EncodedFilterData &getEncodedFilterData(const FilterData &fd) = 0;
+
+	// If this is properly encoded filter data, then return the original filter-data pointer
+	virtual FilterData * getFilterData(const EncodedFilterData &d) const = 0;
+
+	virtual bool isEncodedFilterData(const EncodedFilterData &d) const = 0;
+
+	// see if these two objects interact and, if so, return the weighting value to apply
+	virtual bool getWeightedFilter(const EncodedFilterData &o1,const EncodedFilterData &o2,float &weight) = 0;
+
+	virtual void release(FilterData &fb) = 0;
+
+	virtual void release(void) = 0;
+
+protected:
+	virtual ~FilterBits(void)
+	{
+	}
+};
+
+FilterBits *createFilterBits(void);
+
+extern FilterBits *gFilterBits;
+
+
+#endif
diff --git a/APEX_1.4/shared/external/include/Find.h b/APEX_1.4/shared/external/include/Find.h
new file mode 100644
index 00000000..a40f5105
--- /dev/null
+++ b/APEX_1.4/shared/external/include/Find.h
@@ -0,0 +1,28 @@
+/*
+ * Copyright (c) 2008-2015, NVIDIA CORPORATION.  All rights reserved.
+ *
+ * NVIDIA CORPORATION and its licensors retain all intellectual property
+ * and proprietary rights in and to this software, related documentation
+ * and any modifications thereto.  Any use, reproduction, disclosure or
+ * distribution of this software and related documentation without an express
+ * license agreement from NVIDIA CORPORATION is strictly prohibited.
+ */
+
+
+#ifndef FIND_H
+#define FIND_H
+
+namespace nvidia {
+namespace apex {
+
+class FileHandler
+{
+public:
+	virtual void handle(const char*) = 0;
+};
+
+void Find(const char* root, FileHandler& f, const char** ignoredFiles = 0);
+
+}}
+
+#endif
diff --git a/APEX_1.4/shared/external/include/GL/glext.h b/APEX_1.4/shared/external/include/GL/glext.h
new file mode 100644
index 00000000..4a2628b0
--- /dev/null
+++ b/APEX_1.4/shared/external/include/GL/glext.h
@@ -0,0 +1,3336 @@
+/*
+ * Copyright (c) 2008-2015, NVIDIA CORPORATION.  All rights reserved.
+ *
+ * NVIDIA CORPORATION and its licensors retain all intellectual property
+ * and proprietary rights in and to this software, related documentation
+ * and any modifications thereto.  Any use, reproduction, disclosure or
+ * distribution of this software and related documentation without an express
+ * license agreement from NVIDIA CORPORATION is strictly prohibited.
+ */
+
+
+#ifndef __glext_h_
+#define __glext_h_
+
+#ifdef __cplusplus
+extern "C" {
+#endif
+
+	/*
+	** License Applicability. Except to the extent portions of this file are
+	** made subject to an alternative license as permitted in the SGI Free
+	** Software License B, Version 1.1 (the "License"), the contents of this
+	** file are subject only to the provisions of the License. You may not use
+	** this file except in compliance with the License. You may obtain a copy
+	** of the License at Silicon Graphics, Inc., attn: Legal Services, 1600
+	** Amphitheatre Parkway, Mountain View, CA 94043-1351, or at:
+	**
+	** http://oss.sgi.com/projects/FreeB
+	**
+	** Note that, as provided in the License, the Software is distributed on an
+	** "AS IS" basis, with ALL EXPRESS AND IMPLIED WARRANTIES AND CONDITIONS
+	** DISCLAIMED, INCLUDING, WITHOUT LIMITATION, ANY IMPLIED WARRANTIES AND
+	** CONDITIONS OF MERCHANTABILITY, SATISFACTORY QUALITY, FITNESS FOR A
+	** PARTICULAR PURPOSE, AND NON-INFRINGEMENT.
+	**
+	** Original Code. The Original Code is: OpenGL Sample Implementation,
+	** Version 1.2.1, released January 26, 2000, developed by Silicon Graphics,
+	** Inc. The Original Code is Copyright (c) 1991-2000 Silicon Graphics, Inc.
+	** Copyright in any portions created by third parties is as indicated
+	** elsewhere herein. All Rights Reserved.
+	**
+	** Additional Notice Provisions: This software was created using the
+	** OpenGL(R) version 1.2.1 Sample Implementation published by SGI, but has
+	** not been independently verified as being compliant with the OpenGL(R)
+	** version 1.2.1 Specification.
+	*/
+
+#if defined(_WIN32) && !defined(APIENTRY) && !defined(__CYGWIN__)
+#define WIN32_LEAN_AND_MEAN 1
+#include <windows.h>
+#endif
+
+#ifndef APIENTRY
+#define APIENTRY
+#endif
+
+	/*************************************************************/
+
+	/* Header file version number, required by OpenGL ABI for Linux */
+#define GL_GLEXT_VERSION 6
+
+#ifndef GL_VERSION_1_2
+#define GL_CONSTANT_COLOR                 0x8001
+#define GL_ONE_MINUS_CONSTANT_COLOR       0x8002
+#define GL_CONSTANT_ALPHA                 0x8003
+#define GL_ONE_MINUS_CONSTANT_ALPHA       0x8004
+#define GL_BLEND_COLOR                    0x8005
+#define GL_FUNC_ADD                       0x8006
+#define GL_MIN                            0x8007
+#define GL_MAX                            0x8008
+#define GL_BLEND_EQUATION                 0x8009
+#define GL_FUNC_SUBTRACT                  0x800A
+#define GL_FUNC_REVERSE_SUBTRACT          0x800B
+#define GL_CONVOLUTION_1D                 0x8010
+#define GL_CONVOLUTION_2D                 0x8011
+#define GL_SEPARABLE_2D                   0x8012
+#define GL_CONVOLUTION_BORDER_MODE        0x8013
+#define GL_CONVOLUTION_FILTER_SCALE       0x8014
+#define GL_CONVOLUTION_FILTER_BIAS        0x8015
+#define GL_REDUCE                         0x8016
+#define GL_CONVOLUTION_FORMAT             0x8017
+#define GL_CONVOLUTION_WIDTH              0x8018
+#define GL_CONVOLUTION_HEIGHT             0x8019
+#define GL_MAX_CONVOLUTION_WIDTH          0x801A
+#define GL_MAX_CONVOLUTION_HEIGHT         0x801B
+#define GL_POST_CONVOLUTION_RED_SCALE     0x801C
+#define GL_POST_CONVOLUTION_GREEN_SCALE   0x801D
+#define GL_POST_CONVOLUTION_BLUE_SCALE    0x801E
+#define GL_POST_CONVOLUTION_ALPHA_SCALE   0x801F
+#define GL_POST_CONVOLUTION_RED_BIAS      0x8020
+#define GL_POST_CONVOLUTION_GREEN_BIAS    0x8021
+#define GL_POST_CONVOLUTION_BLUE_BIAS     0x8022
+#define GL_POST_CONVOLUTION_ALPHA_BIAS    0x8023
+#define GL_HISTOGRAM                      0x8024
+#define GL_PROXY_HISTOGRAM                0x8025
+#define GL_HISTOGRAM_WIDTH                0x8026
+#define GL_HISTOGRAM_FORMAT               0x8027
+#define GL_HISTOGRAM_RED_SIZE             0x8028
+#define GL_HISTOGRAM_GREEN_SIZE           0x8029
+#define GL_HISTOGRAM_BLUE_SIZE            0x802A
+#define GL_HISTOGRAM_ALPHA_SIZE           0x802B
+#define GL_HISTOGRAM_LUMINANCE_SIZE       0x802C
+#define GL_HISTOGRAM_SINK                 0x802D
+#define GL_MINMAX                         0x802E
+#define GL_MINMAX_FORMAT                  0x802F
+#define GL_MINMAX_SINK                    0x8030
+#define GL_TABLE_TOO_LARGE                0x8031
+#define GL_UNSIGNED_BYTE_3_3_2            0x8032
+#define GL_UNSIGNED_SHORT_4_4_4_4         0x8033
+#define GL_UNSIGNED_SHORT_5_5_5_1         0x8034
+#define GL_UNSIGNED_INT_8_8_8_8           0x8035
+#define GL_UNSIGNED_INT_10_10_10_2        0x8036
+#define GL_RESCALE_NORMAL                 0x803A
+#define GL_UNSIGNED_BYTE_2_3_3_REV        0x8362
+#define GL_UNSIGNED_SHORT_5_6_5           0x8363
+#define GL_UNSIGNED_SHORT_5_6_5_REV       0x8364
+#define GL_UNSIGNED_SHORT_4_4_4_4_REV     0x8365
+#define GL_UNSIGNED_SHORT_1_5_5_5_REV     0x8366
+#define GL_UNSIGNED_INT_8_8_8_8_REV       0x8367
+#define GL_UNSIGNED_INT_2_10_10_10_REV    0x8368
+#define GL_COLOR_MATRIX                   0x80B1
+#define GL_COLOR_MATRIX_STACK_DEPTH       0x80B2
+#define GL_MAX_COLOR_MATRIX_STACK_DEPTH   0x80B3
+#define GL_POST_COLOR_MATRIX_RED_SCALE    0x80B4
+#define GL_POST_COLOR_MATRIX_GREEN_SCALE  0x80B5
+#define GL_POST_COLOR_MATRIX_BLUE_SCALE   0x80B6
+#define GL_POST_COLOR_MATRIX_ALPHA_SCALE  0x80B7
+#define GL_POST_COLOR_MATRIX_RED_BIAS     0x80B8
+#define GL_POST_COLOR_MATRIX_GREEN_BIAS   0x80B9
+#define GL_POST_COLOR_MATRIX_BLUE_BIAS    0x80BA
+#define GL_COLOR_TABLE                    0x80D0
+#define GL_POST_CONVOLUTION_COLOR_TABLE   0x80D1
+#define GL_POST_COLOR_MATRIX_COLOR_TABLE  0x80D2
+#define GL_PROXY_COLOR_TABLE              0x80D3
+#define GL_PROXY_POST_CONVOLUTION_COLOR_TABLE 0x80D4
+#define GL_PROXY_POST_COLOR_MATRIX_COLOR_TABLE 0x80D5
+#define GL_COLOR_TABLE_SCALE              0x80D6
+#define GL_COLOR_TABLE_BIAS               0x80D7
+#define GL_COLOR_TABLE_FORMAT             0x80D8
+#define GL_COLOR_TABLE_WIDTH              0x80D9
+#define GL_COLOR_TABLE_RED_SIZE           0x80DA
+#define GL_COLOR_TABLE_GREEN_SIZE         0x80DB
+#define GL_COLOR_TABLE_BLUE_SIZE          0x80DC
+#define GL_COLOR_TABLE_ALPHA_SIZE         0x80DD
+#define GL_COLOR_TABLE_LUMINANCE_SIZE     0x80DE
+#define GL_COLOR_TABLE_INTENSITY_SIZE     0x80DF
+#define GL_CLAMP_TO_EDGE                  0x812F
+#define GL_TEXTURE_MIN_LOD                0x813A
+#define GL_TEXTURE_MAX_LOD                0x813B
+#define GL_TEXTURE_BASE_LEVEL             0x813C
+#define GL_TEXTURE_MAX_LEVEL              0x813D
+#define GL_LIGHT_MODEL_COLOR_CONTROL      0x81F8
+#define GL_SINGLE_COLOR                   0x81F9
+#define GL_SEPARATE_SPECULAR_COLOR        0x81FA
+
+#define GL_COMBINE                    0x8570
+#define GL_COMBINE_RGB                0x8571
+#define GL_COMBINE_ALPHA              0x8572
+#define GL_RGB_SCALE                  0x8573
+#define GL_ADD_SIGNED                 0x8574
+#define GL_INTERPOLATE                0x8575
+#define GL_CONSTANT                   0x8576
+#define GL_PRIMARY_COLOR              0x8577
+#define GL_PREVIOUS                   0x8578
+#define GL_SOURCE0_RGB                0x8580
+#define GL_SOURCE1_RGB                0x8581
+#define GL_SOURCE2_RGB                0x8582
+#define GL_SOURCE3_RGB                0x8583
+#define GL_SOURCE4_RGB                0x8584
+#define GL_SOURCE5_RGB                0x8585
+#define GL_SOURCE6_RGB                0x8586
+#define GL_SOURCE7_RGB                0x8587
+#define GL_SOURCE0_ALPHA              0x8588
+#define GL_SOURCE1_ALPHA              0x8589
+#define GL_SOURCE2_ALPHA              0x858A
+#define GL_SOURCE3_ALPHA              0x858B
+#define GL_SOURCE4_ALPHA              0x858C
+#define GL_SOURCE5_ALPHA              0x858D
+#define GL_SOURCE6_ALPHA              0x858E
+#define GL_SOURCE7_ALPHA              0x858F
+#define GL_OPERAND0_RGB               0x8590
+#define GL_OPERAND1_RGB               0x8591
+#define GL_OPERAND2_RGB               0x8592
+#define GL_OPERAND3_RGB               0x8593
+#define GL_OPERAND4_RGB               0x8594
+#define GL_OPERAND5_RGB               0x8595
+#define GL_OPERAND6_RGB               0x8596
+#define GL_OPERAND7_RGB               0x8597
+#define GL_OPERAND0_ALPHA             0x8598
+#define GL_OPERAND1_ALPHA             0x8599
+#define GL_OPERAND2_ALPHA             0x859A
+#define GL_OPERAND3_ALPHA             0x859B
+#define GL_OPERAND4_ALPHA             0x859C
+#define GL_OPERAND5_ALPHA             0x859D
+#define GL_OPERAND6_ALPHA             0x859E
+#define GL_OPERAND7_ALPHA             0x859F
+#define GL_SUBTRACT                   0x84E7
+#define GL_DOT3_RGB                   0x86AE
+#define GL_DOT3_RGBA                  0x86AF
+
+#define GL_TEXTURE0                   0x84C0
+#define GL_TEXTURE1                   0x84C1
+#define GL_TEXTURE2                   0x84C2
+#define GL_TEXTURE3                   0x84C3
+#define GL_TEXTURE4                   0x84C4
+#define GL_TEXTURE5                   0x84C5
+#define GL_TEXTURE6                   0x84C6
+#define GL_TEXTURE7                   0x84C7
+#define GL_TEXTURE8                   0x84C8
+#define GL_TEXTURE9                   0x84C9
+#define GL_TEXTURE10                  0x84CA
+#define GL_TEXTURE11                  0x84CB
+#define GL_TEXTURE12                  0x84CC
+#define GL_TEXTURE13                  0x84CD
+#define GL_TEXTURE14                  0x84CE
+#define GL_TEXTURE15                  0x84CF
+#define GL_TEXTURE16                  0x84D0
+#define GL_TEXTURE17                  0x84D1
+#define GL_TEXTURE18                  0x84D2
+#define GL_TEXTURE19                  0x84D3
+#define GL_TEXTURE20                  0x84D4
+#define GL_TEXTURE21                  0x84D5
+#define GL_TEXTURE22                  0x84D6
+#define GL_TEXTURE23                  0x84D7
+#define GL_TEXTURE24                  0x84D8
+#define GL_TEXTURE25                  0x84D9
+#define GL_TEXTURE26                  0x84DA
+#define GL_TEXTURE27                  0x84DB
+#define GL_TEXTURE28                  0x84DC
+#define GL_TEXTURE29                  0x84DD
+#define GL_TEXTURE30                  0x84DE
+#define GL_TEXTURE31                  0x84DF
+#define GL_ACTIVE_TEXTURE             0x84E0
+#define GL_CLIENT_ACTIVE_TEXTURE      0x84E1
+#define GL_MAX_TEXTURE_UNITS          0x84E2
+#define GL_CLAMP_TO_BORDER            0x812D
+
+#define GL_BGR			              0x80E0
+#define GL_BGRA         		      0x80E1
+#endif
+
+#ifndef GL_APPLE_specular_vector
+#define GL_LIGHT_MODEL_SPECULAR_VECTOR_APPLE 0x85B0
+#endif
+
+#ifndef GL_APPLE_transform_hint
+#define GL_TRANSFORM_HINT_APPLE           0x85B1
+#endif
+
+#ifndef GL_ARB_depth_texture
+#define GL_DEPTH_COMPONENT16_ARB          0x81A5
+#define GL_DEPTH_COMPONENT24_ARB          0x81A6
+#define GL_DEPTH_COMPONENT32_ARB          0x81A7
+#define GL_TEXTURE_DEPTH_SIZE_ARB         0x884A
+#define GL_DEPTH_TEXTURE_MODE_ARB         0x884B
+#endif
+
+#ifndef GL_ARB_fragment_program
+#define GL_FRAGMENT_PROGRAM_ARB                     0x8804
+#define GL_PROGRAM_ALU_INSTRUCTIONS_ARB             0x8805
+#define GL_PROGRAM_TEX_INSTRUCTIONS_ARB             0x8806
+#define GL_PROGRAM_TEX_INDIRECTIONS_ARB             0x8807
+#define GL_PROGRAM_NATIVE_ALU_INSTRUCTIONS_ARB      0x8808
+#define GL_PROGRAM_NATIVE_TEX_INSTRUCTIONS_ARB      0x8809
+#define GL_PROGRAM_NATIVE_TEX_INDIRECTIONS_ARB      0x880A
+#define GL_MAX_PROGRAM_ALU_INSTRUCTIONS_ARB         0x880B
+#define GL_MAX_PROGRAM_TEX_INSTRUCTIONS_ARB         0x880C
+#define GL_MAX_PROGRAM_TEX_INDIRECTIONS_ARB         0x880D
+#define GL_MAX_PROGRAM_NATIVE_ALU_INSTRUCTIONS_ARB  0x880E
+#define GL_MAX_PROGRAM_NATIVE_TEX_INSTRUCTIONS_ARB  0x880F
+#define GL_MAX_PROGRAM_NATIVE_TEX_INDIRECTIONS_ARB  0x8810
+#define GL_MAX_TEXTURE_COORDS_ARB                   0x8871
+#define GL_MAX_TEXTURE_IMAGE_UNITS_ARB              0x8872
+#endif
+
+#ifndef GL_ARB_multisample
+#define WGL_SAMPLE_BUFFERS_ARB            0x2041
+#define WGL_SAMPLES_ARB                   0x2042
+#define GL_MULTISAMPLE_ARB                0x809D
+#define GL_SAMPLE_ALPHA_TO_COVERAGE_ARB   0x809E
+#define GL_SAMPLE_ALPHA_TO_ONE_ARB        0x809F
+#define GL_SAMPLE_COVERAGE_ARB            0x80A0
+#define GL_SAMPLE_BUFFERS_ARB             0x80A8
+#define GL_SAMPLES_ARB                    0x80A9
+#define GL_SAMPLE_COVERAGE_VALUE_ARB      0x80AA
+#define GL_SAMPLE_COVERAGE_INVERT_ARB     0x80AB
+#define GL_MULTISAMPLE_BIT_ARB            0x20000000
+#endif
+
+#ifndef GL_ARB_multitexture
+#define GL_TEXTURE0_ARB                   0x84C0
+#define GL_TEXTURE1_ARB                   0x84C1
+#define GL_TEXTURE2_ARB                   0x84C2
+#define GL_TEXTURE3_ARB                   0x84C3
+#define GL_TEXTURE4_ARB                   0x84C4
+#define GL_TEXTURE5_ARB                   0x84C5
+#define GL_TEXTURE6_ARB                   0x84C6
+#define GL_TEXTURE7_ARB                   0x84C7
+#define GL_TEXTURE8_ARB                   0x84C8
+#define GL_TEXTURE9_ARB                   0x84C9
+#define GL_TEXTURE10_ARB                  0x84CA
+#define GL_TEXTURE11_ARB                  0x84CB
+#define GL_TEXTURE12_ARB                  0x84CC
+#define GL_TEXTURE13_ARB                  0x84CD
+#define GL_TEXTURE14_ARB                  0x84CE
+#define GL_TEXTURE15_ARB                  0x84CF
+#define GL_TEXTURE16_ARB                  0x84D0
+#define GL_TEXTURE17_ARB                  0x84D1
+#define GL_TEXTURE18_ARB                  0x84D2
+#define GL_TEXTURE19_ARB                  0x84D3
+#define GL_TEXTURE20_ARB                  0x84D4
+#define GL_TEXTURE21_ARB                  0x84D5
+#define GL_TEXTURE22_ARB                  0x84D6
+#define GL_TEXTURE23_ARB                  0x84D7
+#define GL_TEXTURE24_ARB                  0x84D8
+#define GL_TEXTURE25_ARB                  0x84D9
+#define GL_TEXTURE26_ARB                  0x84DA
+#define GL_TEXTURE27_ARB                  0x84DB
+#define GL_TEXTURE28_ARB                  0x84DC
+#define GL_TEXTURE29_ARB                  0x84DD
+#define GL_TEXTURE30_ARB                  0x84DE
+#define GL_TEXTURE31_ARB                  0x84DF
+#define GL_ACTIVE_TEXTURE_ARB             0x84E0
+#define GL_CLIENT_ACTIVE_TEXTURE_ARB      0x84E1
+#define GL_MAX_TEXTURE_UNITS_ARB          0x84E2
+#endif
+
+#ifndef GL_ARB_point_parameters
+#define GL_POINT_SIZE_MIN_ARB                0x8126
+#define GL_POINT_SIZE_MAX_ARB                0x8127
+#define GL_POINT_FADE_THRESHOLD_SIZE_ARB     0x8128
+#define GL_POINT_DISTANCE_ATTENUATION_ARB    0x8129
+#endif
+
+#ifndef GL_ARB_shadow
+#define GL_TEXTURE_COMPARE_MODE_ARB       0x884C
+#define GL_TEXTURE_COMPARE_FUNC_ARB       0x884D
+#define GL_COMPARE_R_TO_TEXTURE_ARB       0x884E
+#endif
+
+#ifndef GL_ARB_texture_border_clamp
+#define GL_CLAMP_TO_BORDER_ARB            0x812D
+#endif
+
+#ifndef GL_ARB_texture_compression
+#define GL_COMPRESSED_ALPHA_ARB           0x84E9
+#define GL_COMPRESSED_LUMINANCE_ARB       0x84EA
+#define GL_COMPRESSED_LUMINANCE_ALPHA_ARB 0x84EB
+#define GL_COMPRESSED_INTENSITY_ARB       0x84EC
+#define GL_COMPRESSED_RGB_ARB             0x84ED
+#define GL_COMPRESSED_RGBA_ARB            0x84EE
+#define GL_TEXTURE_COMPRESSION_HINT_ARB   0x84EF
+#define GL_TEXTURE_IMAGE_SIZE_ARB         0x86A0
+#define GL_TEXTURE_COMPRESSED_ARB         0x86A1
+#define GL_NUM_COMPRESSED_TEXTURE_FORMATS_ARB 0x86A2
+#define GL_COMPRESSED_TEXTURE_FORMATS_ARB 0x86A3
+#endif
+
+#ifndef GL_ARB_texture_cube_map
+#define GL_NORMAL_MAP_ARB                 0x8511
+#define GL_REFLECTION_MAP_ARB             0x8512
+#define GL_TEXTURE_CUBE_MAP_ARB           0x8513
+#define GL_TEXTURE_BINDING_CUBE_MAP_ARB   0x8514
+#define GL_TEXTURE_CUBE_MAP_POSITIVE_X_ARB 0x8515
+#define GL_TEXTURE_CUBE_MAP_NEGATIVE_X_ARB 0x8516
+#define GL_TEXTURE_CUBE_MAP_POSITIVE_Y_ARB 0x8517
+#define GL_TEXTURE_CUBE_MAP_NEGATIVE_Y_ARB 0x8518
+#define GL_TEXTURE_CUBE_MAP_POSITIVE_Z_ARB 0x8519
+#define GL_TEXTURE_CUBE_MAP_NEGATIVE_Z_ARB 0x851A
+#define GL_PROXY_TEXTURE_CUBE_MAP_ARB     0x851B
+#define GL_MAX_CUBE_MAP_TEXTURE_SIZE_ARB  0x851C
+#endif
+
+#ifndef GL_ARB_texture_env_add
+#endif
+
+#ifndef GL_ARB_texture_env_combine
+#define GL_COMBINE_ARB                    0x8570
+#define GL_COMBINE_RGB_ARB                0x8571
+#define GL_COMBINE_ALPHA_ARB              0x8572
+#define GL_RGB_SCALE_ARB                  0x8573
+#define GL_ADD_SIGNED_ARB                 0x8574
+#define GL_INTERPOLATE_ARB                0x8575
+#define GL_CONSTANT_ARB                   0x8576
+#define GL_PRIMARY_COLOR_ARB              0x8577
+#define GL_PREVIOUS_ARB                   0x8578
+#define GL_SOURCE0_RGB_ARB                0x8580
+#define GL_SOURCE1_RGB_ARB                0x8581
+#define GL_SOURCE2_RGB_ARB                0x8582
+#define GL_SOURCE0_ALPHA_ARB              0x8588
+#define GL_SOURCE1_ALPHA_ARB              0x8589
+#define GL_SOURCE2_ALPHA_ARB              0x858A
+#define GL_OPERAND0_RGB_ARB               0x8590
+#define GL_OPERAND1_RGB_ARB               0x8591
+#define GL_OPERAND2_RGB_ARB               0x8592
+#define GL_OPERAND0_ALPHA_ARB             0x8598
+#define GL_OPERAND1_ALPHA_ARB             0x8599
+#define GL_OPERAND2_ALPHA_ARB             0x859A
+#define GL_SUBTRACT_ARB                   0x84E7
+#endif
+
+#ifndef GL_ARB_texture_env_dot3
+#define GL_DOT3_RGB_ARB                   0x86AE
+#define GL_DOT3_RGBA_ARB                  0x86AF
+#endif
+
+#ifndef GL_ARB_texture_mirrored_repeat
+#define GL_MIRRORED_REPEAT_ARB            0x8370
+#endif
+
+#ifndef GL_ARB_transpose_matrix
+#define GL_TRANSPOSE_MODELVIEW_MATRIX_ARB 0x84E3
+#define GL_TRANSPOSE_PROJECTION_MATRIX_ARB 0x84E4
+#define GL_TRANSPOSE_TEXTURE_MATRIX_ARB   0x84E5
+#define GL_TRANSPOSE_COLOR_MATRIX_ARB     0x84E6
+#endif
+
+#ifndef GL_ARB_vertex_buffer_object
+#define GL_ARRAY_BUFFER_ARB                             0x8892
+#define GL_ELEMENT_ARRAY_BUFFER_ARB                     0x8893
+#define GL_ARRAY_BUFFER_BINDING_ARB                     0x8894
+#define GL_ELEMENT_ARRAY_BUFFER_BINDING_ARB             0x8895
+#define GL_VERTEX_ARRAY_BUFFER_BINDING_ARB              0x8896
+#define GL_NORMAL_ARRAY_BUFFER_BINDING_ARB              0x8897
+#define GL_COLOR_ARRAY_BUFFER_BINDING_ARB               0x8898
+#define GL_INDEX_ARRAY_BUFFER_BINDING_ARB               0x8899
+#define TEXTURE_COORD_ARRAY_BUFFER_BINDING_ARB          0x889A
+#define GL_EDGE_FLAG_ARRAY_BUFFER_BINDING_ARB           0x889B
+#define GL_SECONDARY_COLOR_ARRAY_BUFFER_BINDING_ARB     0x889C
+#define GL_FOG_COORDINATE_ARRAY_BUFFER_BINDING_ARB      0x889D
+#define GL_WEIGHT_ARRAY_BUFFER_BINDING_ARB              0x889E
+#define GL_VERTEX_ATTRIB_ARRAY_BUFFER_BINDING_ARB       0x889F
+#define GL_STREAM_DRAW_ARB                              0x88E0
+#define GL_STREAM_READ_ARB                              0x88E1
+#define GL_STREAM_COPY_ARB                              0x88E2
+#define GL_STATIC_DRAW_ARB                              0x88E4
+#define GL_STATIC_READ_ARB                              0x88E5
+#define GL_STATIC_COPY_ARB                              0x88E6
+#define GL_DYNAMIC_DRAW_ARB                             0x88E8
+#define GL_DYNAMIC_READ_ARB                             0x88E9
+#define GL_DYNAMIC_COPY_ARB                             0x88EA
+#define GL_READ_ONLY_ARB                                0x88B8
+#define GL_WRITE_ONLY_ARB                               0x88B9
+#define GL_READ_WRITE_ARB                               0x88BA
+#define GL_BUFFER_SIZE_ARB                              0x8764
+#define GL_BUFFER_USAGE_ARB                             0x8765
+#define GL_BUFFER_ACCESS_ARB                            0x88BB
+#define GL_BUFFER_MAPPED_ARB                            0x88BC
+#define GL_BUFFER_MAP_POINTER_ARB                       0x88BD
+#endif
+
+#ifndef GL_ARB_vertex_program
+#define GL_VERTEX_PROGRAM_ARB                       0x8620
+#define GL_VERTEX_PROGRAM_POINT_SIZE_ARB            0x8642
+#define GL_VERTEX_PROGRAM_TWO_SIDE_ARB              0x8643
+#define GL_COLOR_SUM_ARB                            0x8458
+#define GL_PROGRAM_FORMAT_ASCII_ARB                 0x8875
+#define GL_VERTEX_ATTRIB_ARRAY_ENABLED_ARB          0x8622
+#define GL_VERTEX_ATTRIB_ARRAY_SIZE_ARB             0x8623
+#define GL_VERTEX_ATTRIB_ARRAY_STRIDE_ARB           0x8624
+#define GL_VERTEX_ATTRIB_ARRAY_TYPE_ARB             0x8625
+#define GL_VERTEX_ATTRIB_ARRAY_NORMALIZED_ARB       0x886A
+#define GL_CURRENT_VERTEX_ATTRIB_ARB                0x8626
+#define GL_VERTEX_ATTRIB_ARRAY_POINTER_ARB          0x8645
+#define GL_PROGRAM_LENGTH_ARB                       0x8627
+#define GL_PROGRAM_FORMAT_ARB                       0x8876
+#define GL_PROGRAM_BINDING_ARB                      0x8677
+#define GL_PROGRAM_INSTRUCTIONS_ARB                 0x88A0
+#define GL_MAX_PROGRAM_INSTRUCTIONS_ARB             0x88A1
+#define GL_PROGRAM_NATIVE_INSTRUCTIONS_ARB          0x88A2
+#define GL_MAX_PROGRAM_NATIVE_INSTRUCTIONS_ARB      0x88A3
+#define GL_PROGRAM_TEMPORARIES_ARB                  0x88A4
+#define GL_MAX_PROGRAM_TEMPORARIES_ARB              0x88A5
+#define GL_PROGRAM_NATIVE_TEMPORARIES_ARB           0x88A6
+#define GL_MAX_PROGRAM_NATIVE_TEMPORARIES_ARB       0x88A7
+#define GL_PROGRAM_PARAMETERS_ARB                   0x88A8
+#define GL_MAX_PROGRAM_PARAMETERS_ARB               0x88A9
+#define GL_PROGRAM_NATIVE_PARAMETERS_ARB            0x88AA
+#define GL_MAX_PROGRAM_NATIVE_PARAMETERS_ARB        0x88AB
+#define GL_PROGRAM_ATTRIBS_ARB                      0x88AC
+#define GL_MAX_PROGRAM_ATTRIBS_ARB                  0x88AD
+#define GL_PROGRAM_NATIVE_ATTRIBS_ARB               0x88AE
+#define GL_MAX_PROGRAM_NATIVE_ATTRIBS_ARB           0x88AF
+#define GL_PROGRAM_ADDRESS_REGISTERS_ARB            0x88B0
+#define GL_MAX_PROGRAM_ADDRESS_REGISTERS_ARB        0x88B1
+#define GL_PROGRAM_NATIVE_ADDRESS_REGISTERS_ARB     0x88B2
+#define GL_MAX_PROGRAM_NATIVE_ADDRESS_REGISTERS_ARB 0x88B3
+#define GL_MAX_PROGRAM_LOCAL_PARAMETERS_ARB         0x88B4
+#define GL_MAX_PROGRAM_ENV_PARAMETERS_ARB           0x88B5
+#define GL_PROGRAM_UNDER_NATIVE_LIMITS_ARB          0x88B6
+#define GL_PROGRAM_STRING_ARB                       0x8628
+#define GL_PROGRAM_ERROR_POSITION_ARB               0x864B
+#define GL_CURRENT_MATRIX_ARB                       0x8641
+#define GL_TRANSPOSE_CURRENT_MATRIX_ARB             0x88B7
+#define GL_CURRENT_MATRIX_STACK_DEPTH_ARB           0x8640
+#define GL_MAX_VERTEX_ATTRIBS_ARB                   0x8869
+#define GL_MAX_PROGRAM_MATRICES_ARB                 0x862F
+#define GL_MAX_PROGRAM_MATRIX_STACK_DEPTH_ARB       0x862E
+#define GL_PROGRAM_ERROR_STRING_ARB                 0x8874
+#define GL_MATRIX0_ARB                              0x88C0
+#define GL_MATRIX1_ARB                              0x88C1
+#define GL_MATRIX2_ARB                              0x88C2
+#define GL_MATRIX3_ARB                              0x88C3
+#define GL_MATRIX4_ARB                              0x88C4
+#define GL_MATRIX5_ARB                              0x88C5
+#define GL_MATRIX6_ARB                              0x88C6
+#define GL_MATRIX7_ARB                              0x88C7
+#define GL_MATRIX8_ARB                              0x88C8
+#define GL_MATRIX9_ARB                              0x88C9
+#define GL_MATRIX10_ARB                             0x88CA
+#define GL_MATRIX11_ARB                             0x88CB
+#define GL_MATRIX12_ARB                             0x88CC
+#define GL_MATRIX13_ARB                             0x88CD
+#define GL_MATRIX14_ARB                             0x88CE
+#define GL_MATRIX15_ARB                             0x88CF
+#define GL_MATRIX16_ARB                             0x88D0
+#define GL_MATRIX17_ARB                             0x88D1
+#define GL_MATRIX18_ARB                             0x88D2
+#define GL_MATRIX19_ARB                             0x88D3
+#define GL_MATRIX20_ARB                             0x88D4
+#define GL_MATRIX21_ARB                             0x88D5
+#define GL_MATRIX22_ARB                             0x88D6
+#define GL_MATRIX23_ARB                             0x88D7
+#define GL_MATRIX24_ARB                             0x88D8
+#define GL_MATRIX25_ARB                             0x88D9
+#define GL_MATRIX26_ARB                             0x88DA
+#define GL_MATRIX27_ARB                             0x88DB
+#define GL_MATRIX28_ARB                             0x88DC
+#define GL_MATRIX29_ARB                             0x88DD
+#define GL_MATRIX30_ARB                             0x88DE
+#define GL_MATRIX31_ARB                             0x88DF
+#endif
+
+#ifndef GL_ARB_window_pos
+#endif
+
+#ifndef GL_EXT_422_pixels
+#define GL_422_EXT                        0x80CC
+#define GL_422_REV_EXT                    0x80CD
+#define GL_422_AVERAGE_EXT                0x80CE
+#define GL_422_REV_AVERAGE_EXT            0x80CF
+#endif
+
+#ifndef GL_EXT_abgr
+#define GL_ABGR_EXT                       0x8000
+#endif
+
+#ifndef GL_EXT_bgra
+#define GL_BGR_EXT                        0x80E0
+#define GL_BGRA_EXT                       0x80E1
+#endif
+
+#ifndef GL_EXT_blend_color
+#define GL_CONSTANT_COLOR_EXT             0x8001
+#define GL_ONE_MINUS_CONSTANT_COLOR_EXT   0x8002
+#define GL_CONSTANT_ALPHA_EXT             0x8003
+#define GL_ONE_MINUS_CONSTANT_ALPHA_EXT   0x8004
+#define GL_BLEND_COLOR_EXT                0x8005
+#endif
+
+#ifndef GL_EXT_blend_func_separate
+#define GL_BLEND_DST_RGB_EXT              0x80C8
+#define GL_BLEND_SRC_RGB_EXT              0x80C9
+#define GL_BLEND_DST_ALPHA_EXT            0x80CA
+#define GL_BLEND_SRC_ALPHA_EXT            0x80CB
+#endif
+
+#ifndef GL_EXT_blend_logic_op
+#endif
+
+#ifndef GL_EXT_blend_minmax
+#define GL_FUNC_ADD_EXT                   0x8006
+#define GL_MIN_EXT                        0x8007
+#define GL_MAX_EXT                        0x8008
+#define GL_BLEND_EQUATION_EXT             0x8009
+#endif
+
+#ifndef GL_EXT_blend_subtract
+#define GL_FUNC_SUBTRACT_EXT              0x800A
+#define GL_FUNC_REVERSE_SUBTRACT_EXT      0x800B
+#endif
+
+#ifndef GL_EXT_polygon_offset
+#define GL_POLYGON_OFFSET_EXT             0x8037
+#define GL_POLYGON_OFFSET_FACTOR_EXT      0x8038
+#define GL_POLYGON_OFFSET_BIAS_EXT        0x8039
+#endif
+
+#ifndef GL_EXT_clip_volume_hint
+#define GL_CLIP_VOLUME_CLIPPING_HINT_EXT  0x80F0
+#endif
+
+#ifndef GL_EXT_cmyka
+#define GL_CMYK_EXT                       0x800C
+#define GL_CMYKA_EXT                      0x800D
+#define GL_PACK_CMYK_HINT_EXT             0x800E
+#define GL_UNPACK_CMYK_HINT_EXT           0x800F
+#endif
+
+#ifndef GL_EXT_color_subtable
+#endif
+
+#ifndef GL_EXT_compiled_vertex_array
+#define GL_ARRAY_ELEMENT_LOCK_FIRST_EXT   0x81A8
+#define GL_ARRAY_ELEMENT_LOCK_COUNT_EXT   0x81A9
+#endif
+
+#ifndef GL_EXT_convolution
+#define GL_CONVOLUTION_1D_EXT             0x8010
+#define GL_CONVOLUTION_2D_EXT             0x8011
+#define GL_SEPARABLE_2D_EXT               0x8012
+#define GL_CONVOLUTION_BORDER_MODE_EXT    0x8013
+#define GL_CONVOLUTION_FILTER_SCALE_EXT   0x8014
+#define GL_CONVOLUTION_FILTER_BIAS_EXT    0x8015
+#define GL_REDUCE_EXT                     0x8016
+#define GL_CONVOLUTION_FORMAT_EXT         0x8017
+#define GL_CONVOLUTION_WIDTH_EXT          0x8018
+#define GL_CONVOLUTION_HEIGHT_EXT         0x8019
+#define GL_MAX_CONVOLUTION_WIDTH_EXT      0x801A
+#define GL_MAX_CONVOLUTION_HEIGHT_EXT     0x801B
+#define GL_POST_CONVOLUTION_RED_SCALE_EXT 0x801C
+#define GL_POST_CONVOLUTION_GREEN_SCALE_EXT 0x801D
+#define GL_POST_CONVOLUTION_BLUE_SCALE_EXT 0x801E
+#define GL_POST_CONVOLUTION_ALPHA_SCALE_EXT 0x801F
+#define GL_POST_CONVOLUTION_RED_BIAS_EXT  0x8020
+#define GL_POST_CONVOLUTION_GREEN_BIAS_EXT 0x8021
+#define GL_POST_CONVOLUTION_BLUE_BIAS_EXT 0x8022
+#define GL_POST_CONVOLUTION_ALPHA_BIAS_EXT 0x8023
+#endif
+
+#ifndef GL_EXT_copy_texture
+#endif
+
+#ifndef GL_EXT_cull_vertex
+#define GL_CULL_VERTEX_EXT                0x81AA
+#define GL_CULL_VERTEX_EYE_POSITION_EXT   0x81AB
+#define GL_CULL_VERTEX_OBJECT_POSITION_EXT 0x81AC
+#endif
+
+#ifndef GL_EXT_draw_range_elements
+#define GL_MAX_ELEMENTS_VERTICES_EXT      0x80E8
+#define GL_MAX_ELEMENTS_INDICES_EXT       0x80E9
+#endif
+
+#ifndef GL_EXT_fog_coord
+#define GL_FOG_COORDINATE_SOURCE_EXT      0x8450
+#define GL_FOG_COORDINATE_EXT             0x8451
+#define GL_FRAGMENT_DEPTH_EXT             0x8452
+#define GL_CURRENT_FOG_COORDINATE_EXT     0x8453
+#define GL_FOG_COORDINATE_ARRAY_TYPE_EXT  0x8454
+#define GL_FOG_COORDINATE_ARRAY_STRIDE_EXT 0x8455
+#define GL_FOG_COORDINATE_ARRAY_POINTER_EXT 0x8456
+#define GL_FOG_COORDINATE_ARRAY_EXT       0x8457
+#endif
+
+#ifndef GL_EXT_histogram
+#define GL_HISTOGRAM_EXT                  0x8024
+#define GL_PROXY_HISTOGRAM_EXT            0x8025
+#define GL_HISTOGRAM_WIDTH_EXT            0x8026
+#define GL_HISTOGRAM_FORMAT_EXT           0x8027
+#define GL_HISTOGRAM_RED_SIZE_EXT         0x8028
+#define GL_HISTOGRAM_GREEN_SIZE_EXT       0x8029
+#define GL_HISTOGRAM_BLUE_SIZE_EXT        0x802A
+#define GL_HISTOGRAM_ALPHA_SIZE_EXT       0x802B
+#define GL_HISTOGRAM_LUMINANCE_SIZE_EXT   0x802C
+#define GL_HISTOGRAM_SINK_EXT             0x802D
+#define GL_MINMAX_EXT                     0x802E
+#define GL_MINMAX_FORMAT_EXT              0x802F
+#define GL_MINMAX_SINK_EXT                0x8030
+#define GL_TABLE_TOO_LARGE_EXT            0x8031
+#endif
+
+#ifndef GL_EXT_misc_attribute
+#endif
+
+#ifndef GL_EXT_index_array_formats
+#define GL_IUI_V2F_EXT                    0x81AD
+#define GL_IUI_V3F_EXT                    0x81AE
+#define GL_IUI_N3F_V2F_EXT                0x81AF
+#define GL_IUI_N3F_V3F_EXT                0x81B0
+#define GL_T2F_IUI_V2F_EXT                0x81B1
+#define GL_T2F_IUI_V3F_EXT                0x81B2
+#define GL_T2F_IUI_N3F_V2F_EXT            0x81B3
+#define GL_T2F_IUI_N3F_V3F_EXT            0x81B4
+#endif
+
+#ifndef GL_EXT_index_func
+#define GL_INDEX_TEST_EXT                 0x81B5
+#define GL_INDEX_TEST_FUNC_EXT            0x81B6
+#define GL_INDEX_TEST_REF_EXT             0x81B7
+#endif
+
+#ifndef GL_EXT_index_material
+#define GL_INDEX_MATERIAL_EXT             0x81B8
+#define GL_INDEX_MATERIAL_PARAMETER_EXT   0x81B9
+#define GL_INDEX_MATERIAL_FACE_EXT        0x81BA
+#endif
+
+#ifndef GL_EXT_index_texture
+#endif
+
+#ifndef GL_EXT_light_texture
+#define GL_FRAGMENT_MATERIAL_EXT          0x8349
+#define GL_FRAGMENT_NORMAL_EXT            0x834A
+#define GL_FRAGMENT_COLOR_EXT             0x834C
+#define GL_ATTENUATION_EXT                0x834D
+#define GL_SHADOW_ATTENUATION_EXT         0x834E
+#define GL_TEXTURE_APPLICATION_MODE_EXT   0x834F
+#define GL_TEXTURE_LIGHT_EXT              0x8350
+#define GL_TEXTURE_MATERIAL_FACE_EXT      0x8351
+#define GL_TEXTURE_MATERIAL_PARAMETER_EXT 0x8352
+	/* reuse GL_FRAGMENT_DEPTH_EXT */
+#endif
+
+#ifndef GL_EXT_multi_draw_arrays
+#endif
+
+#ifndef GL_EXT_packed_pixels
+#define GL_UNSIGNED_BYTE_3_3_2_EXT        0x8032
+#define GL_UNSIGNED_SHORT_4_4_4_4_EXT     0x8033
+#define GL_UNSIGNED_SHORT_5_5_5_1_EXT     0x8034
+#define GL_UNSIGNED_INT_8_8_8_8_EXT       0x8035
+#define GL_UNSIGNED_INT_10_10_10_2_EXT    0x8036
+#endif
+
+#ifndef GL_EXT_paletted_texture
+#define GL_COLOR_INDEX1_EXT               0x80E2
+#define GL_COLOR_INDEX2_EXT               0x80E3
+#define GL_COLOR_INDEX4_EXT               0x80E4
+#define GL_COLOR_INDEX8_EXT               0x80E5
+#define GL_COLOR_INDEX12_EXT              0x80E6
+#define GL_COLOR_INDEX16_EXT              0x80E7
+#define GL_TEXTURE_INDEX_SIZE_EXT         0x80ED
+#endif
+
+#ifndef GL_EXT_pixel_transform
+#define GL_PIXEL_TRANSFORM_2D_EXT         0x8330
+#define GL_PIXEL_MAG_FILTER_EXT           0x8331
+#define GL_PIXEL_MIN_FILTER_EXT           0x8332
+#define GL_PIXEL_CUBIC_WEIGHT_EXT         0x8333
+#define GL_CUBIC_EXT                      0x8334
+#define GL_AVERAGE_EXT                    0x8335
+#define GL_PIXEL_TRANSFORM_2D_STACK_DEPTH_EXT 0x8336
+#define GL_MAX_PIXEL_TRANSFORM_2D_STACK_DEPTH_EXT 0x8337
+#define GL_PIXEL_TRANSFORM_2D_MATRIX_EXT  0x8338
+#endif
+
+#ifndef GL_EXT_pixel_transform_color_table
+#endif
+
+#ifndef GL_EXT_point_parameters
+#define GL_POINT_SIZE_MIN_EXT             0x8126
+#define GL_POINT_SIZE_MAX_EXT             0x8127
+#define GL_POINT_FADE_THRESHOLD_SIZE_EXT  0x8128
+#define GL_DISTANCE_ATTENUATION_EXT       0x8129
+#endif
+
+#ifndef GL_EXT_rescale_normal
+#define GL_RESCALE_NORMAL_EXT             0x803A
+#endif
+
+#ifndef GL_EXT_secondary_color
+#define GL_COLOR_SUM_EXT                  0x8458
+#define GL_CURRENT_SECONDARY_COLOR_EXT    0x8459
+#define GL_SECONDARY_COLOR_ARRAY_SIZE_EXT 0x845A
+#define GL_SECONDARY_COLOR_ARRAY_TYPE_EXT 0x845B
+#define GL_SECONDARY_COLOR_ARRAY_STRIDE_EXT 0x845C
+#define GL_SECONDARY_COLOR_ARRAY_POINTER_EXT 0x845D
+#define GL_SECONDARY_COLOR_ARRAY_EXT      0x845E
+#endif
+
+#ifndef GL_EXT_separate_specular_color
+#define GL_LIGHT_MODEL_COLOR_CONTROL_EXT  0x81F8
+#define GL_SINGLE_COLOR_EXT               0x81F9
+#define GL_SEPARATE_SPECULAR_COLOR_EXT    0x81FA
+#endif
+
+#ifndef GL_EXT_shadow_funcs
+#endif
+
+#ifndef GL_EXT_shared_texture_palette
+#define GL_SHARED_TEXTURE_PALETTE_EXT     0x81FB
+#endif
+
+#ifndef GL_EXT_stencil_two_side
+#define GL_STENCIL_TEST_TWO_SIDE_EXT      0x8910
+#define GL_ACTIVE_STENCIL_FACE_EXT        0x8911
+#endif
+
+#ifndef GL_EXT_stencil_wrap
+#define GL_INCR_WRAP_EXT                  0x8507
+#define GL_DECR_WRAP_EXT                  0x8508
+#endif
+
+#ifndef GL_EXT_subtexture
+#endif
+
+#ifndef GL_EXT_texture
+#define GL_ALPHA4_EXT                     0x803B
+#define GL_ALPHA8_EXT                     0x803C
+#define GL_ALPHA12_EXT                    0x803D
+#define GL_ALPHA16_EXT                    0x803E
+#define GL_LUMINANCE4_EXT                 0x803F
+#define GL_LUMINANCE8_EXT                 0x8040
+#define GL_LUMINANCE12_EXT                0x8041
+#define GL_LUMINANCE16_EXT                0x8042
+#define GL_LUMINANCE4_ALPHA4_EXT          0x8043
+#define GL_LUMINANCE6_ALPHA2_EXT          0x8044
+#define GL_LUMINANCE8_ALPHA8_EXT          0x8045
+#define GL_LUMINANCE12_ALPHA4_EXT         0x8046
+#define GL_LUMINANCE12_ALPHA12_EXT        0x8047
+#define GL_LUMINANCE16_ALPHA16_EXT        0x8048
+#define GL_INTENSITY_EXT                  0x8049
+#define GL_INTENSITY4_EXT                 0x804A
+#define GL_INTENSITY8_EXT                 0x804B
+#define GL_INTENSITY12_EXT                0x804C
+#define GL_INTENSITY16_EXT                0x804D
+#define GL_RGB2_EXT                       0x804E
+#define GL_RGB4_EXT                       0x804F
+#define GL_RGB5_EXT                       0x8050
+#define GL_RGB8_EXT                       0x8051
+#define GL_RGB10_EXT                      0x8052
+#define GL_RGB12_EXT                      0x8053
+#define GL_RGB16_EXT                      0x8054
+#define GL_RGBA2_EXT                      0x8055
+#define GL_RGBA4_EXT                      0x8056
+#define GL_RGB5_A1_EXT                    0x8057
+#define GL_RGBA8_EXT                      0x8058
+#define GL_RGB10_A2_EXT                   0x8059
+#define GL_RGBA12_EXT                     0x805A
+#define GL_RGBA16_EXT                     0x805B
+#define GL_TEXTURE_RED_SIZE_EXT           0x805C
+#define GL_TEXTURE_GREEN_SIZE_EXT         0x805D
+#define GL_TEXTURE_BLUE_SIZE_EXT          0x805E
+#define GL_TEXTURE_ALPHA_SIZE_EXT         0x805F
+#define GL_TEXTURE_LUMINANCE_SIZE_EXT     0x8060
+#define GL_TEXTURE_INTENSITY_SIZE_EXT     0x8061
+#define GL_REPLACE_EXT                    0x8062
+#define GL_PROXY_TEXTURE_1D_EXT           0x8063
+#define GL_PROXY_TEXTURE_2D_EXT           0x8064
+#define GL_TEXTURE_TOO_LARGE_EXT          0x8065
+#endif
+
+#ifndef GL_EXT_texture_compression_s3tc
+#define GL_COMPRESSED_RGB_S3TC_DXT1_EXT   0x83F0
+#define GL_COMPRESSED_RGBA_S3TC_DXT1_EXT  0x83F1
+#define GL_COMPRESSED_RGBA_S3TC_DXT3_EXT  0x83F2
+#define GL_COMPRESSED_RGBA_S3TC_DXT5_EXT  0x83F3
+#endif
+
+#ifndef GL_EXT_texture_cube_map
+#define GL_NORMAL_MAP_EXT                 0x8511
+#define GL_REFLECTION_MAP_EXT             0x8512
+#define GL_TEXTURE_CUBE_MAP_EXT           0x8513
+#define GL_TEXTURE_BINDING_CUBE_MAP_EXT   0x8514
+#define GL_TEXTURE_CUBE_MAP_POSITIVE_X_EXT 0x8515
+#define GL_TEXTURE_CUBE_MAP_NEGATIVE_X_EXT 0x8516
+#define GL_TEXTURE_CUBE_MAP_POSITIVE_Y_EXT 0x8517
+#define GL_TEXTURE_CUBE_MAP_NEGATIVE_Y_EXT 0x8518
+#define GL_TEXTURE_CUBE_MAP_POSITIVE_Z_EXT 0x8519
+#define GL_TEXTURE_CUBE_MAP_NEGATIVE_Z_EXT 0x851A
+#define GL_PROXY_TEXTURE_CUBE_MAP_EXT     0x851B
+#define GL_MAX_CUBE_MAP_TEXTURE_SIZE_EXT  0x851C
+#endif
+
+#ifndef GL_EXT_coordinate_frame
+#define GL_TANGENT_ARRAY_EXT              0x8439
+#define GL_BINORMAL_ARRAY_EXT             0x843A
+#define GL_CURRENT_TANGENT_EXT            0x843B
+#define GL_CURRENT_BINORMAL_EXT           0x843C
+#define GL_TANGENT_ARRAY_TYPE_EXT         0x843E
+#define GL_TANGENT_ARRAY_STRIDE_EXT       0x843F
+#define GL_BINORMAL_ARRAY_TYPE_EXT        0x8440
+#define GL_BINORMAL_ARRAY_STRIDE_EXT      0x8441
+#define GL_TANGENT_ARRAY_POINTER_EXT      0x8442
+#define GL_BINORMAL_ARRAY_POINTER_EXT     0x8443
+#define GL_MAP1_TANGENT_EXT               0x8444
+#define GL_MAP2_TANGENT_EXT               0x8445
+#define GL_MAP1_BINORMAL_EXT              0x8446
+#define GL_MAP2_BINORMAL_EXT              0x8447
+#endif
+
+#ifndef GL_EXT_texture_edge_clamp
+#define CLAMP_TO_EDGE_EXT                 0x812F
+#endif
+
+#ifndef GL_EXT_texture_env_add
+#endif
+
+#ifndef GL_EXT_texture_env_combine
+#define GL_COMBINE_EXT                    0x8570
+#define GL_COMBINE_RGB_EXT                0x8571
+#define GL_COMBINE_ALPHA_EXT              0x8572
+#define GL_RGB_SCALE_EXT                  0x8573
+#define GL_ADD_SIGNED_EXT                 0x8574
+#define GL_INTERPOLATE_EXT                0x8575
+#define GL_CONSTANT_EXT                   0x8576
+#define GL_PRIMARY_COLOR_EXT              0x8577
+#define GL_PREVIOUS_EXT                   0x8578
+#define GL_SOURCE0_RGB_EXT                0x8580
+#define GL_SOURCE1_RGB_EXT                0x8581
+#define GL_SOURCE2_RGB_EXT                0x8582
+#define GL_SOURCE3_RGB_EXT                0x8583
+#define GL_SOURCE4_RGB_EXT                0x8584
+#define GL_SOURCE5_RGB_EXT                0x8585
+#define GL_SOURCE6_RGB_EXT                0x8586
+#define GL_SOURCE7_RGB_EXT                0x8587
+#define GL_SOURCE0_ALPHA_EXT              0x8588
+#define GL_SOURCE1_ALPHA_EXT              0x8589
+#define GL_SOURCE2_ALPHA_EXT              0x858A
+#define GL_SOURCE3_ALPHA_EXT              0x858B
+#define GL_SOURCE4_ALPHA_EXT              0x858C
+#define GL_SOURCE5_ALPHA_EXT              0x858D
+#define GL_SOURCE6_ALPHA_EXT              0x858E
+#define GL_SOURCE7_ALPHA_EXT              0x858F
+#define GL_OPERAND0_RGB_EXT               0x8590
+#define GL_OPERAND1_RGB_EXT               0x8591
+#define GL_OPERAND2_RGB_EXT               0x8592
+#define GL_OPERAND3_RGB_EXT               0x8593
+#define GL_OPERAND4_RGB_EXT               0x8594
+#define GL_OPERAND5_RGB_EXT               0x8595
+#define GL_OPERAND6_RGB_EXT               0x8596
+#define GL_OPERAND7_RGB_EXT               0x8597
+#define GL_OPERAND0_ALPHA_EXT             0x8598
+#define GL_OPERAND1_ALPHA_EXT             0x8599
+#define GL_OPERAND2_ALPHA_EXT             0x859A
+#define GL_OPERAND3_ALPHA_EXT             0x859B
+#define GL_OPERAND4_ALPHA_EXT             0x859C
+#define GL_OPERAND5_ALPHA_EXT             0x859D
+#define GL_OPERAND6_ALPHA_EXT             0x859E
+#define GL_OPERAND7_ALPHA_EXT             0x859F
+#endif
+
+#ifndef GL_EXT_texture_env_dot3
+#define GL_DOT3_RGB_EXT                   0x8740
+#define GL_DOT3_RGBA_EXT                  0x8741
+#endif
+
+#ifndef GL_EXT_texture_filter_anisotropic
+#define GL_TEXTURE_MAX_ANISOTROPY_EXT     0x84FE
+#define GL_MAX_TEXTURE_MAX_ANISOTROPY_EXT 0x84FF
+#endif
+
+#ifndef GL_EXT_texture_lod_bias
+#define GL_MAX_TEXTURE_LOD_BIAS_EXT       0x84FD
+#define GL_TEXTURE_FILTER_CONTROL_EXT     0x8500
+#define GL_TEXTURE_LOD_BIAS_EXT           0x8501
+#endif
+
+#ifndef GL_EXT_texture_object
+#define GL_TEXTURE_PRIORITY_EXT           0x8066
+#define GL_TEXTURE_RESIDENT_EXT           0x8067
+#define GL_TEXTURE_1D_BINDING_EXT         0x8068
+#define GL_TEXTURE_2D_BINDING_EXT         0x8069
+#define GL_TEXTURE_3D_BINDING_EXT         0x806A
+#endif
+
+#ifndef GL_EXT_texture_perturb_normal
+#define GL_PERTURB_EXT                    0x85AE
+#define GL_TEXTURE_NORMAL_EXT             0x85AF
+#endif
+
+#ifndef GL_EXT_texture3D
+#define GL_PACK_SKIP_IMAGES               0x806B
+#define GL_PACK_SKIP_IMAGES_EXT           0x806B
+#define GL_PACK_IMAGE_HEIGHT              0x806C
+#define GL_PACK_IMAGE_HEIGHT_EXT          0x806C
+#define GL_UNPACK_SKIP_IMAGES             0x806D
+#define GL_UNPACK_SKIP_IMAGES_EXT         0x806D
+#define GL_UNPACK_IMAGE_HEIGHT            0x806E
+#define GL_UNPACK_IMAGE_HEIGHT_EXT        0x806E
+#define GL_TEXTURE_3D                     0x806F
+#define GL_TEXTURE_3D_EXT                 0x806F
+#define GL_PROXY_TEXTURE_3D               0x8070
+#define GL_PROXY_TEXTURE_3D_EXT           0x8070
+#define GL_TEXTURE_DEPTH                  0x8071
+#define GL_TEXTURE_DEPTH_EXT              0x8071
+#define GL_TEXTURE_WRAP_R                 0x8072
+#define GL_TEXTURE_WRAP_R_EXT             0x8072
+#define GL_MAX_3D_TEXTURE_SIZE            0x8073
+#define GL_MAX_3D_TEXTURE_SIZE_EXT        0x8073
+#endif
+
+#ifndef GL_EXT_vertex_array
+#define GL_VERTEX_ARRAY_EXT               0x8074
+#define GL_NORMAL_ARRAY_EXT               0x8075
+#define GL_COLOR_ARRAY_EXT                0x8076
+#define GL_INDEX_ARRAY_EXT                0x8077
+#define GL_TEXTURE_COORD_ARRAY_EXT        0x8078
+#define GL_EDGE_FLAG_ARRAY_EXT            0x8079
+#define GL_VERTEX_ARRAY_SIZE_EXT          0x807A
+#define GL_VERTEX_ARRAY_TYPE_EXT          0x807B
+#define GL_VERTEX_ARRAY_STRIDE_EXT        0x807C
+#define GL_VERTEX_ARRAY_COUNT_EXT         0x807D
+#define GL_NORMAL_ARRAY_TYPE_EXT          0x807E
+#define GL_NORMAL_ARRAY_STRIDE_EXT        0x807F
+#define GL_NORMAL_ARRAY_COUNT_EXT         0x8080
+#define GL_COLOR_ARRAY_SIZE_EXT           0x8081
+#define GL_COLOR_ARRAY_TYPE_EXT           0x8082
+#define GL_COLOR_ARRAY_STRIDE_EXT         0x8083
+#define GL_COLOR_ARRAY_COUNT_EXT          0x8084
+#define GL_INDEX_ARRAY_TYPE_EXT           0x8085
+#define GL_INDEX_ARRAY_STRIDE_EXT         0x8086
+#define GL_INDEX_ARRAY_COUNT_EXT          0x8087
+#define GL_TEXTURE_COORD_ARRAY_SIZE_EXT   0x8088
+#define GL_TEXTURE_COORD_ARRAY_TYPE_EXT   0x8089
+#define GL_TEXTURE_COORD_ARRAY_STRIDE_EXT 0x808A
+#define GL_TEXTURE_COORD_ARRAY_COUNT_EXT  0x808B
+#define GL_EDGE_FLAG_ARRAY_STRIDE_EXT     0x808C
+#define GL_EDGE_FLAG_ARRAY_COUNT_EXT      0x808D
+#define GL_VERTEX_ARRAY_POINTER_EXT       0x808E
+#define GL_NORMAL_ARRAY_POINTER_EXT       0x808F
+#define GL_COLOR_ARRAY_POINTER_EXT        0x8090
+#define GL_INDEX_ARRAY_POINTER_EXT        0x8091
+#define GL_TEXTURE_COORD_ARRAY_POINTER_EXT 0x8092
+#define GL_EDGE_FLAG_ARRAY_POINTER_EXT    0x8093
+#endif
+
+#ifndef GL_EXT_vertex_weighting
+#define GL_MODELVIEW0_STACK_DEPTH_EXT     GL_MODELVIEW_STACK_DEPTH
+#define GL_MODELVIEW1_STACK_DEPTH_EXT     0x8502
+#define GL_MODELVIEW0_MATRIX_EXT          GL_MODELVIEW_MATRIX
+#define GL_MODELVIEW_MATRIX1_EXT          0x8506
+#define GL_VERTEX_WEIGHTING_EXT           0x8509
+#define GL_MODELVIEW0_EXT                 GL_MODELVIEW
+#define GL_MODELVIEW1_EXT                 0x850A
+#define GL_CURRENT_VERTEX_WEIGHT_EXT      0x850B
+#define GL_VERTEX_WEIGHT_ARRAY_EXT        0x850C
+#define GL_VERTEX_WEIGHT_ARRAY_SIZE_EXT   0x850D
+#define GL_VERTEX_WEIGHT_ARRAY_TYPE_EXT   0x850E
+#define GL_VERTEX_WEIGHT_ARRAY_STRIDE_EXT 0x850F
+#define GL_VERTEX_WEIGHT_ARRAY_POINTER_EXT 0x8510
+#endif
+
+#ifndef GL_HP_occlusion_test
+#define GL_OCCLUSION_TEST_HP              0x8165
+#define GL_OCCLUSION_TEST_RESULT_HP       0x8166
+#endif
+
+#ifndef GL_HP_convolution_border_modes
+#define GL_IGNORE_BORDER_HP               0x8150
+#define GL_CONSTANT_BORDER_HP             0x8151
+#define GL_REPLICATE_BORDER_HP            0x8153
+#define GL_CONVOLUTION_BORDER_COLOR_HP    0x8154
+#endif
+
+#ifndef GL_HP_image_transform
+#define GL_IMAGE_SCALE_X_HP               0x8155
+#define GL_IMAGE_SCALE_Y_HP               0x8156
+#define GL_IMAGE_TRANSLATE_X_HP           0x8157
+#define GL_IMAGE_TRANSLATE_Y_HP           0x8158
+#define GL_IMAGE_ROTATE_ANGLE_HP          0x8159
+#define GL_IMAGE_ROTATE_ORIGIN_X_HP       0x815A
+#define GL_IMAGE_ROTATE_ORIGIN_Y_HP       0x815B
+#define GL_IMAGE_MAG_FILTER_HP            0x815C
+#define GL_IMAGE_MIN_FILTER_HP            0x815D
+#define GL_IMAGE_CUBIC_WEIGHT_HP          0x815E
+#define GL_CUBIC_HP                       0x815F
+#define GL_AVERAGE_HP                     0x8160
+#define GL_IMAGE_TRANSFORM_2D_HP          0x8161
+#define GL_POST_IMAGE_TRANSFORM_COLOR_TABLE_HP 0x8162
+#define GL_PROXY_POST_IMAGE_TRANSFORM_COLOR_TABLE_HP 0x8163
+#endif
+
+#ifndef GL_HP_texture_lighting
+#define GL_TEXTURE_LIGHTING_MODE_HP       0x8167
+#define GL_TEXTURE_POST_SPECULAR_HP       0x8168
+#define GL_TEXTURE_PRE_SPECULAR_HP        0x8169
+#endif
+
+#ifndef GL_IBM_cull_vertex
+#define GL_CULL_VERTEX_IBM                103050
+#endif
+
+#ifndef GL_IBM_multimode_draw_arrays
+#endif
+
+#ifndef GL_IBM_rasterpos_clip
+#define GL_RASTER_POSITION_UNCLIPPED_IBM  0x19262
+#endif
+
+#ifndef GL_IBM_texture_mirrored_repeat
+#define GL_MIRRORED_REPEAT_IBM            0x8370
+#endif
+
+#ifndef GL_IBM_vertex_array_lists
+#define GL_VERTEX_ARRAY_LIST_IBM          103070
+#define GL_NORMAL_ARRAY_LIST_IBM          103071
+#define GL_COLOR_ARRAY_LIST_IBM           103072
+#define GL_INDEX_ARRAY_LIST_IBM           103073
+#define GL_TEXTURE_COORD_ARRAY_LIST_IBM   103074
+#define GL_EDGE_FLAG_ARRAY_LIST_IBM       103075
+#define GL_FOG_COORDINATE_ARRAY_LIST_IBM  103076
+#define GL_SECONDARY_COLOR_ARRAY_LIST_IBM 103077
+#define GL_VERTEX_ARRAY_LIST_STRIDE_IBM   103080
+#define GL_NORMAL_ARRAY_LIST_STRIDE_IBM   103081
+#define GL_COLOR_ARRAY_LIST_STRIDE_IBM    103082
+#define GL_INDEX_ARRAY_LIST_STRIDE_IBM    103083
+#define GL_TEXTURE_COORD_ARRAY_LIST_STRIDE_IBM 103084
+#define GL_EDGE_FLAG_ARRAY_LIST_STRIDE_IBM 103085
+#define GL_FOG_COORDINATE_ARRAY_LIST_STRIDE_IBM 103086
+#define GL_SECONDARY_COLOR_ARRAY_LIST_STRIDE_IBM 103087
+#endif
+
+#ifndef GL_INGR_color_clamp
+#define GL_RED_MIN_CLAMP_INGR             0x8560
+#define GL_GREEN_MIN_CLAMP_INGR           0x8561
+#define GL_BLUE_MIN_CLAMP_INGR            0x8562
+#define GL_ALPHA_MIN_CLAMP_INGR           0x8563
+#define GL_RED_MAX_CLAMP_INGR             0x8564
+#define GL_GREEN_MAX_CLAMP_INGR           0x8565
+#define GL_BLUE_MAX_CLAMP_INGR            0x8566
+#define GL_ALPHA_MAX_CLAMP_INGR           0x8567
+#endif
+
+#ifndef GL_INGR_interlace_read
+#define GL_INTERLACE_READ_INGR            0x8568
+#endif
+
+#ifndef GL_INGR_palette_buffer
+#endif
+
+#ifndef GL_INTEL_parallel_arrays
+#define GL_PARALLEL_ARRAYS_INTEL          0x83F4
+#define GL_VERTEX_ARRAY_PARALLEL_POINTERS_INTEL 0x83F5
+#define GL_NORMAL_ARRAY_PARALLEL_POINTERS_INTEL 0x83F6
+#define GL_COLOR_ARRAY_PARALLEL_POINTERS_INTEL 0x83F7
+#define GL_TEXTURE_COORD_ARRAY_PARALLEL_POINTERS_INTEL 0x83F8
+#endif
+
+#ifndef GL_INTEL_texture_scissor
+#endif
+
+#ifndef GL_MESA_resize_buffers
+#endif
+
+#ifndef GL_MESA_window_pos
+#endif
+
+#ifndef GL_NV_blend_square
+#endif
+
+#ifndef GL_NV_copy_depth_to_color
+#define GL_DEPTH_STENCIL_TO_RGBA_NV       0x886E
+#define GL_DEPTH_STENCIL_TO_BGRA_NV       0x886F
+#endif
+
+#ifndef GL_NV_depth_clamp
+#define GL_DEPTH_CLAMP_NV                 0x864F
+#endif
+
+#ifndef GL_NV_element_array
+#define GL_ELEMENT_ARRAY_TYPE_NV          0x8769
+#define GL_ELEMENT_ARRAY_POINTER_NV       0x876A
+#endif
+
+#ifndef GL_NV_fence
+#define GL_ALL_COMPLETED_NV               0x84F2
+#define GL_FENCE_STATUS_NV                0x84F3
+#define GL_FENCE_CONDITION_NV             0x84F4
+#endif
+
+#ifndef GL_NV_float_buffer
+#define GL_FLOAT_R_NV                     0x8880
+#define GL_FLOAT_RG_NV                    0x8881
+#define GL_FLOAT_RGB_NV                   0x8882
+#define GL_FLOAT_RGBA_NV                  0x8883
+#define GL_FLOAT_R16_NV                   0x8884
+#define GL_FLOAT_R32_NV                   0x8885
+#define GL_FLOAT_RG16_NV                  0x8886
+#define GL_FLOAT_RG32_NV                  0x8887
+#define GL_FLOAT_RGB16_NV                 0x8888
+#define GL_FLOAT_RGB32_NV                 0x8889
+#define GL_FLOAT_RGBA16_NV                0x888A
+#define GL_FLOAT_RGBA32_NV                0x888B
+#define GL_TEXTURE_FLOAT_COMPONENTS_NV    0x888C
+#define GL_FLOAT_CLEAR_COLOR_VALUE_NV     0x888D
+#define GL_FLOAT_RGBA_MODE_NV             0x888E
+#endif
+
+#ifndef GL_NV_fog_distance
+#define GL_FOG_DISTANCE_MODE_NV           0x855A
+#define GL_EYE_RADIAL_NV                  0x855B
+#define GL_EYE_PLANE_ABSOLUTE_NV          0x855C
+	/* reuse GL_EYE_PLANE */
+#endif
+
+#ifndef GL_NV_fragment_program
+#define GL_FRAGMENT_PROGRAM_NV            0x8870
+#define GL_MAX_TEXTURE_COORDS_NV          0x8871
+#define GL_MAX_TEXTURE_IMAGE_UNITS_NV     0x8872
+#define GL_FRAGMENT_PROGRAM_BINDING_NV    0x8873
+#define GL_PROGRAM_ERROR_STRING_NV        0x8874
+#define GL_MAX_FRAGMENT_PROGRAM_LOCAL_PARAMETERS_NV 0x8868
+#endif
+
+#ifndef GL_NV_half_float
+#define GL_HALF_FLOAT_NV                  0x140B
+#endif
+
+#ifndef GL_NV_light_max_exponent
+#define GL_MAX_SHININESS_NV               0x8504
+#define GL_MAX_SPOT_EXPONENT_NV           0x8505
+#endif
+
+#ifndef GL_NV_multisample_filter_hint
+#define GL_MULTISAMPLE_FILTER_HINT_NV     0x8534
+#endif
+
+#ifndef GL_NV_occlusion_query
+#define GL_PIXEL_COUNTER_BITS_NV          0x8864
+#define GL_CURRENT_OCCLUSION_QUERY_ID_NV  0x8865
+#define GL_PIXEL_COUNT_NV                 0x8866
+#define GL_PIXEL_COUNT_AVAILABLE_NV       0x8867
+#endif
+
+#ifndef GL_NV_packed_depth_stencil
+#define GL_DEPTH_STENCIL_NV               0x84F9
+#define GL_UNSIGNED_INT_24_8_NV           0x84FA
+#endif
+
+#ifndef GL_NV_pixel_data_range
+#define GL_WRITE_PIXEL_DATA_RANGE_NV      0x8878
+#define GL_READ_PIXEL_DATA_RANGE_NV       0x8879
+#define GL_WRITE_PIXEL_DATA_RANGE_LENGTH_NV 0x887A
+#define GL_READ_PIXEL_DATA_RANGE_LENGTH_NV 0x887B
+#define GL_WRITE_PIXEL_DATA_RANGE_POINTER_NV 0x887C
+#define GL_READ_PIXEL_DATA_RANGE_POINTER_NV 0x887D
+#endif
+
+#ifndef GL_NV_point_sprite
+#define GL_POINT_SPRITE_NV                0x8861
+#define GL_COORD_REPLACE_NV               0x8862
+#define GL_POINT_SPRITE_R_MODE_NV         0x8863
+#endif
+
+#ifndef GL_NV_primitive_restart
+#define GL_PRIMITIVE_RESTART_NV           0x8558
+#define GL_PRIMITIVE_RESTART_INDEX_NV     0x8559
+#endif
+
+#ifndef GL_NV_register_combiners
+#define GL_REGISTER_COMBINERS_NV          0x8522
+#define GL_VARIABLE_A_NV                  0x8523
+#define GL_VARIABLE_B_NV                  0x8524
+#define GL_VARIABLE_C_NV                  0x8525
+#define GL_VARIABLE_D_NV                  0x8526
+#define GL_VARIABLE_E_NV                  0x8527
+#define GL_VARIABLE_F_NV                  0x8528
+#define GL_VARIABLE_G_NV                  0x8529
+#define GL_CONSTANT_COLOR0_NV             0x852A
+#define GL_CONSTANT_COLOR1_NV             0x852B
+#define GL_PRIMARY_COLOR_NV               0x852C
+#define GL_SECONDARY_COLOR_NV             0x852D
+#define GL_SPARE0_NV                      0x852E
+#define GL_SPARE1_NV                      0x852F
+#define GL_DISCARD_NV                     0x8530
+#define GL_E_TIMES_F_NV                   0x8531
+#define GL_SPARE0_PLUS_SECONDARY_COLOR_NV 0x8532
+#define GL_UNSIGNED_IDENTITY_NV           0x8536
+#define GL_UNSIGNED_INVERT_NV             0x8537
+#define GL_EXPAND_NORMAL_NV               0x8538
+#define GL_EXPAND_NEGATE_NV               0x8539
+#define GL_HALF_BIAS_NORMAL_NV            0x853A
+#define GL_HALF_BIAS_NEGATE_NV            0x853B
+#define GL_SIGNED_IDENTITY_NV             0x853C
+#define GL_SIGNED_NEGATE_NV               0x853D
+#define GL_SCALE_BY_TWO_NV                0x853E
+#define GL_SCALE_BY_FOUR_NV               0x853F
+#define GL_SCALE_BY_ONE_HALF_NV           0x8540
+#define GL_BIAS_BY_NEGATIVE_ONE_HALF_NV   0x8541
+#define GL_COMBINER_INPUT_NV              0x8542
+#define GL_COMBINER_MAPPING_NV            0x8543
+#define GL_COMBINER_COMPONENT_USAGE_NV    0x8544
+#define GL_COMBINER_AB_DOT_PRODUCT_NV     0x8545
+#define GL_COMBINER_CD_DOT_PRODUCT_NV     0x8546
+#define GL_COMBINER_MUX_SUM_NV            0x8547
+#define GL_COMBINER_SCALE_NV              0x8548
+#define GL_COMBINER_BIAS_NV               0x8549
+#define GL_COMBINER_AB_OUTPUT_NV          0x854A
+#define GL_COMBINER_CD_OUTPUT_NV          0x854B
+#define GL_COMBINER_SUM_OUTPUT_NV         0x854C
+#define GL_MAX_GENERAL_COMBINERS_NV       0x854D
+#define GL_NUM_GENERAL_COMBINERS_NV       0x854E
+#define GL_COLOR_SUM_CLAMP_NV             0x854F
+#define GL_COMBINER0_NV                   0x8550
+#define GL_COMBINER1_NV                   0x8551
+#define GL_COMBINER2_NV                   0x8552
+#define GL_COMBINER3_NV                   0x8553
+#define GL_COMBINER4_NV                   0x8554
+#define GL_COMBINER5_NV                   0x8555
+#define GL_COMBINER6_NV                   0x8556
+#define GL_COMBINER7_NV                   0x8557
+	/* reuse GL_TEXTURE0_ARB */
+	/* reuse GL_TEXTURE1_ARB */
+	/* reuse GL_ZERO */
+	/* reuse GL_NONE */
+	/* reuse GL_FOG */
+#endif
+
+#ifndef GL_NV_register_combiners2
+#define GL_PER_STAGE_CONSTANTS_NV         0x8535
+#endif
+
+#ifndef GL_NV_stencil_two_side
+#define GL_STENCIL_TEST_TWO_SIDE_NV       0x8910
+#define GL_ACTIVE_STENCIL_FACE_NV         0x8911
+#endif
+
+#ifndef GL_NV_texgen_emboss
+#define GL_EMBOSS_LIGHT_NV                0x855D
+#define GL_EMBOSS_CONSTANT_NV             0x855E
+#define GL_EMBOSS_MAP_NV                  0x855F
+#endif
+
+#ifndef GL_NV_texgen_reflection
+#define GL_NORMAL_MAP_NV                  0x8511
+#define GL_REFLECTION_MAP_NV              0x8512
+#endif
+
+#ifndef GL_NV_texture_compression_vtc
+#endif
+
+#ifndef GL_NV_texture_env_combine4
+#define GL_COMBINE4_NV                    0x8503
+#define GL_SOURCE3_RGB_NV                 0x8583
+#define GL_SOURCE3_ALPHA_NV               0x858B
+#define GL_OPERAND3_RGB_NV                0x8593
+#define GL_OPERAND3_ALPHA_NV              0x859B
+#endif
+
+#ifndef GL_NV_texture_rectangle
+#define GL_TEXTURE_RECTANGLE_NV           0x84F5
+#define GL_TEXTURE_BINDING_RECTANGLE_NV   0x84F6
+#define GL_PROXY_TEXTURE_RECTANGLE_NV     0x84F7
+#define GL_MAX_RECTANGLE_TEXTURE_SIZE_NV  0x84F8
+#endif
+
+#ifndef GL_NV_texture_shader
+#define GL_OFFSET_TEXTURE_RECTANGLE_NV    0x864C
+#define GL_OFFSET_TEXTURE_RECTANGLE_SCALE_NV 0x864D
+#define GL_DOT_PRODUCT_TEXTURE_RECTANGLE_NV 0x864E
+#define GL_RGBA_UNSIGNED_DOT_PRODUCT_MAPPING_NV 0x86D9
+#define GL_UNSIGNED_INT_S8_S8_8_8_NV      0x86DA
+#define GL_UNSIGNED_INT_8_8_S8_S8_REV_NV  0x86DB
+#define GL_DSDT_MAG_INTENSITY_NV          0x86DC
+#define GL_SHADER_CONSISTENT_NV           0x86DD
+#define GL_TEXTURE_SHADER_NV              0x86DE
+#define GL_SHADER_OPERATION_NV            0x86DF
+#define GL_CULL_MODES_NV                  0x86E0
+#define GL_OFFSET_TEXTURE_MATRIX_NV       0x86E1
+#define GL_OFFSET_TEXTURE_SCALE_NV        0x86E2
+#define GL_OFFSET_TEXTURE_BIAS_NV         0x86E3
+#define GL_OFFSET_TEXTURE_2D_MATRIX_NV    GL_OFFSET_TEXTURE_MATRIX_NV
+#define GL_OFFSET_TEXTURE_2D_SCALE_NV     GL_OFFSET_TEXTURE_SCALE_NV
+#define GL_OFFSET_TEXTURE_2D_BIAS_NV      GL_OFFSET_TEXTURE_BIAS_NV
+#define GL_PREVIOUS_TEXTURE_INPUT_NV      0x86E4
+#define GL_CONST_EYE_NV                   0x86E5
+#define GL_PASS_THROUGH_NV                0x86E6
+#define GL_CULL_FRAGMENT_NV               0x86E7
+#define GL_OFFSET_TEXTURE_2D_NV           0x86E8
+#define GL_DEPENDENT_AR_TEXTURE_2D_NV     0x86E9
+#define GL_DEPENDENT_GB_TEXTURE_2D_NV     0x86EA
+#define GL_DOT_PRODUCT_NV                 0x86EC
+#define GL_DOT_PRODUCT_DEPTH_REPLACE_NV   0x86ED
+#define GL_DOT_PRODUCT_TEXTURE_2D_NV      0x86EE
+#define GL_DOT_PRODUCT_TEXTURE_3D_NV      0x86EF
+#define GL_DOT_PRODUCT_TEXTURE_CUBE_MAP_NV 0x86F0
+#define GL_DOT_PRODUCT_DIFFUSE_CUBE_MAP_NV 0x86F1
+#define GL_DOT_PRODUCT_REFLECT_CUBE_MAP_NV 0x86F2
+#define GL_DOT_PRODUCT_CONST_EYE_REFLECT_CUBE_MAP_NV 0x86F3
+#define GL_HILO_NV                        0x86F4
+#define GL_DSDT_NV                        0x86F5
+#define GL_DSDT_MAG_NV                    0x86F6
+#define GL_DSDT_MAG_VIB_NV                0x86F7
+#define GL_HILO16_NV                      0x86F8
+#define GL_SIGNED_HILO_NV                 0x86F9
+#define GL_SIGNED_HILO16_NV               0x86FA
+#define GL_SIGNED_RGBA_NV                 0x86FB
+#define GL_SIGNED_RGBA8_NV                0x86FC
+#define GL_SIGNED_RGB_NV                  0x86FE
+#define GL_SIGNED_RGB8_NV                 0x86FF
+#define GL_SIGNED_LUMINANCE_NV            0x8701
+#define GL_SIGNED_LUMINANCE8_NV           0x8702
+#define GL_SIGNED_LUMINANCE_ALPHA_NV      0x8703
+#define GL_SIGNED_LUMINANCE8_ALPHA8_NV    0x8704
+#define GL_SIGNED_ALPHA_NV                0x8705
+#define GL_SIGNED_ALPHA8_NV               0x8706
+#define GL_SIGNED_INTENSITY_NV            0x8707
+#define GL_SIGNED_INTENSITY8_NV           0x8708
+#define GL_DSDT8_NV                       0x8709
+#define GL_DSDT8_MAG8_NV                  0x870A
+#define GL_DSDT8_MAG8_INTENSITY8_NV       0x870B
+#define GL_SIGNED_RGB_UNSIGNED_ALPHA_NV   0x870C
+#define GL_SIGNED_RGB8_UNSIGNED_ALPHA8_NV 0x870D
+#define GL_HI_SCALE_NV                    0x870E
+#define GL_LO_SCALE_NV                    0x870F
+#define GL_DS_SCALE_NV                    0x8710
+#define GL_DT_SCALE_NV                    0x8711
+#define GL_MAGNITUDE_SCALE_NV             0x8712
+#define GL_VIBRANCE_SCALE_NV              0x8713
+#define GL_HI_BIAS_NV                     0x8714
+#define GL_LO_BIAS_NV                     0x8715
+#define GL_DS_BIAS_NV                     0x8716
+#define GL_DT_BIAS_NV                     0x8717
+#define GL_MAGNITUDE_BIAS_NV              0x8718
+#define GL_VIBRANCE_BIAS_NV               0x8719
+#define GL_TEXTURE_BORDER_VALUES_NV       0x871A
+#define GL_TEXTURE_HI_SIZE_NV             0x871B
+#define GL_TEXTURE_LO_SIZE_NV             0x871C
+#define GL_TEXTURE_DS_SIZE_NV             0x871D
+#define GL_TEXTURE_DT_SIZE_NV             0x871E
+#define GL_TEXTURE_MAG_SIZE_NV            0x871F
+#endif
+
+#ifndef GL_NV_texture_shader2
+#define GL_DOT_PRODUCT_TEXTURE_3D_NV      0x86EF
+#endif
+
+#ifndef GL_NV_texture_shader3
+#define GL_OFFSET_PROJECTIVE_TEXTURE_2D_NV 0x8850
+#define GL_OFFSET_PROJECTIVE_TEXTURE_2D_SCALE_NV 0x8851
+#define GL_OFFSET_PROJECTIVE_TEXTURE_RECTANGLE_NV 0x8852
+#define GL_OFFSET_PROJECTIVE_TEXTURE_RECTANGLE_SCALE_NV 0x8853
+#define GL_OFFSET_HILO_TEXTURE_2D_NV      0x8854
+#define GL_OFFSET_HILO_TEXTURE_RECTANGLE_NV 0x8855
+#define GL_OFFSET_HILO_PROJECTIVE_TEXTURE_2D_NV 0x8856
+#define GL_OFFSET_HILO_PROJECTIVE_TEXTURE_RECTANGLE_NV 0x8857
+#define GL_DEPENDENT_HILO_TEXTURE_2D_NV   0x8858
+#define GL_DEPENDENT_RGB_TEXTURE_3D_NV    0x8859
+#define GL_DEPENDENT_RGB_TEXTURE_CUBE_MAP_NV 0x885A
+#define GL_DOT_PRODUCT_PASS_THROUGH_NV    0x885B
+#define GL_DOT_PRODUCT_TEXTURE_1D_NV      0x885C
+#define GL_DOT_PRODUCT_AFFINE_DEPTH_REPLACE_NV 0x885D
+#define GL_HILO8_NV                       0x885E
+#define GL_SIGNED_HILO8_NV                0x885F
+#define GL_FORCE_BLUE_TO_ONE_NV           0x8860
+#endif
+
+#ifndef GL_NV_vertex_array_range
+#define GL_VERTEX_ARRAY_RANGE_NV          0x851D
+#define GL_VERTEX_ARRAY_RANGE_LENGTH_NV   0x851E
+#define GL_VERTEX_ARRAY_RANGE_VALID_NV    0x851F
+#define GL_MAX_VERTEX_ARRAY_RANGE_ELEMENT_NV 0x8520
+#define GL_VERTEX_ARRAY_RANGE_POINTER_NV  0x8521
+#endif
+
+#ifndef GL_NV_vertex_array_range2
+#define GL_VERTEX_ARRAY_RANGE_WITHOUT_FLUSH_NV 0x8533
+#endif
+
+#ifndef GL_NV_vertex_program
+#define GL_VERTEX_PROGRAM_NV              0x8620
+#define GL_VERTEX_STATE_PROGRAM_NV        0x8621
+#define GL_ATTRIB_ARRAY_SIZE_NV           0x8623
+#define GL_ATTRIB_ARRAY_STRIDE_NV         0x8624
+#define GL_ATTRIB_ARRAY_TYPE_NV           0x8625
+#define GL_CURRENT_ATTRIB_NV              0x8626
+#define GL_PROGRAM_LENGTH_NV              0x8627
+#define GL_PROGRAM_STRING_NV              0x8628
+#define GL_MODELVIEW_PROJECTION_NV        0x8629
+#define GL_IDENTITY_NV                    0x862A
+#define GL_INVERSE_NV                     0x862B
+#define GL_TRANSPOSE_NV                   0x862C
+#define GL_INVERSE_TRANSPOSE_NV           0x862D
+#define GL_MAX_TRACK_MATRIX_STACK_DEPTH_NV 0x862E
+#define GL_MAX_TRACK_MATRICES_NV          0x862F
+#define GL_MATRIX0_NV                     0x8630
+#define GL_MATRIX1_NV                     0x8631
+#define GL_MATRIX2_NV                     0x8632
+#define GL_MATRIX3_NV                     0x8633
+#define GL_MATRIX4_NV                     0x8634
+#define GL_MATRIX5_NV                     0x8635
+#define GL_MATRIX6_NV                     0x8636
+#define GL_MATRIX7_NV                     0x8637
+#define GL_CURRENT_MATRIX_STACK_DEPTH_NV  0x8640
+#define GL_CURRENT_MATRIX_NV              0x8641
+#define GL_VERTEX_PROGRAM_POINT_SIZE_NV   0x8642
+#define GL_VERTEX_PROGRAM_TWO_SIDE_NV     0x8643
+#define GL_PROGRAM_PARAMETER_NV           0x8644
+#define GL_ATTRIB_ARRAY_POINTER_NV        0x8645
+#define GL_PROGRAM_TARGET_NV              0x8646
+#define GL_PROGRAM_RESIDENT_NV            0x8647
+#define GL_TRACK_MATRIX_NV                0x8648
+#define GL_TRACK_MATRIX_TRANSFORM_NV      0x8649
+#define GL_VERTEX_PROGRAM_BINDING_NV      0x864A
+#define GL_PROGRAM_ERROR_POSITION_NV      0x864B
+#define GL_VERTEX_ATTRIB_ARRAY0_NV        0x8650
+#define GL_VERTEX_ATTRIB_ARRAY1_NV        0x8651
+#define GL_VERTEX_ATTRIB_ARRAY2_NV        0x8652
+#define GL_VERTEX_ATTRIB_ARRAY3_NV        0x8653
+#define GL_VERTEX_ATTRIB_ARRAY4_NV        0x8654
+#define GL_VERTEX_ATTRIB_ARRAY5_NV        0x8655
+#define GL_VERTEX_ATTRIB_ARRAY6_NV        0x8656
+#define GL_VERTEX_ATTRIB_ARRAY7_NV        0x8657
+#define GL_VERTEX_ATTRIB_ARRAY8_NV        0x8658
+#define GL_VERTEX_ATTRIB_ARRAY9_NV        0x8659
+#define GL_VERTEX_ATTRIB_ARRAY10_NV       0x865A
+#define GL_VERTEX_ATTRIB_ARRAY11_NV       0x865B
+#define GL_VERTEX_ATTRIB_ARRAY12_NV       0x865C
+#define GL_VERTEX_ATTRIB_ARRAY13_NV       0x865D
+#define GL_VERTEX_ATTRIB_ARRAY14_NV       0x865E
+#define GL_VERTEX_ATTRIB_ARRAY15_NV       0x865F
+#define GL_MAP1_VERTEX_ATTRIB0_4_NV       0x8660
+#define GL_MAP1_VERTEX_ATTRIB1_4_NV       0x8661
+#define GL_MAP1_VERTEX_ATTRIB2_4_NV       0x8662
+#define GL_MAP1_VERTEX_ATTRIB3_4_NV       0x8663
+#define GL_MAP1_VERTEX_ATTRIB4_4_NV       0x8664
+#define GL_MAP1_VERTEX_ATTRIB5_4_NV       0x8665
+#define GL_MAP1_VERTEX_ATTRIB6_4_NV       0x8666
+#define GL_MAP1_VERTEX_ATTRIB7_4_NV       0x8667
+#define GL_MAP1_VERTEX_ATTRIB8_4_NV       0x8668
+#define GL_MAP1_VERTEX_ATTRIB9_4_NV       0x8669
+#define GL_MAP1_VERTEX_ATTRIB10_4_NV      0x866A
+#define GL_MAP1_VERTEX_ATTRIB11_4_NV      0x866B
+#define GL_MAP1_VERTEX_ATTRIB12_4_NV      0x866C
+#define GL_MAP1_VERTEX_ATTRIB13_4_NV      0x866D
+#define GL_MAP1_VERTEX_ATTRIB14_4_NV      0x866E
+#define GL_MAP1_VERTEX_ATTRIB15_4_NV      0x866F
+#define GL_MAP2_VERTEX_ATTRIB0_4_NV       0x8670
+#define GL_MAP2_VERTEX_ATTRIB1_4_NV       0x8671
+#define GL_MAP2_VERTEX_ATTRIB2_4_NV       0x8672
+#define GL_MAP2_VERTEX_ATTRIB3_4_NV       0x8673
+#define GL_MAP2_VERTEX_ATTRIB4_4_NV       0x8674
+#define GL_MAP2_VERTEX_ATTRIB5_4_NV       0x8675
+#define GL_MAP2_VERTEX_ATTRIB6_4_NV       0x8676
+#define GL_MAP2_VERTEX_ATTRIB7_4_NV       0x8677
+#define GL_MAP2_VERTEX_ATTRIB8_4_NV       0x8678
+#define GL_MAP2_VERTEX_ATTRIB9_4_NV       0x8679
+#define GL_MAP2_VERTEX_ATTRIB10_4_NV      0x867A
+#define GL_MAP2_VERTEX_ATTRIB11_4_NV      0x867B
+#define GL_MAP2_VERTEX_ATTRIB12_4_NV      0x867C
+#define GL_MAP2_VERTEX_ATTRIB13_4_NV      0x867D
+#define GL_MAP2_VERTEX_ATTRIB14_4_NV      0x867E
+#define GL_MAP2_VERTEX_ATTRIB15_4_NV      0x867F
+#endif
+
+#ifndef GL_NV_vertex_program1_1
+#endif
+
+#ifndef GL_NV_vertex_program2
+#endif
+
+#ifndef GL_PGI_misc_hints
+#define GL_PREFER_DOUBLEBUFFER_HINT_PGI   0x1A1F8
+#define GL_CONSERVE_MEMORY_HINT_PGI       0x1A1FD
+#define GL_RECLAIM_MEMORY_HINT_PGI        0x1A1FE
+#define GL_NATIVE_GRAPHICS_HANDLE_PGI     0x1A202
+#define GL_NATIVE_GRAPHICS_BEGIN_HINT_PGI 0x1A203
+#define GL_NATIVE_GRAPHICS_END_HINT_PGI   0x1A204
+#define GL_ALWAYS_FAST_HINT_PGI           0x1A20C
+#define GL_ALWAYS_SOFT_HINT_PGI           0x1A20D
+#define GL_ALLOW_DRAW_OBJ_HINT_PGI        0x1A20E
+#define GL_ALLOW_DRAW_WIN_HINT_PGI        0x1A20F
+#define GL_ALLOW_DRAW_FRG_HINT_PGI        0x1A210
+#define GL_ALLOW_DRAW_MEM_HINT_PGI        0x1A211
+#define GL_STRICT_DEPTHFUNC_HINT_PGI      0x1A216
+#define GL_STRICT_LIGHTING_HINT_PGI       0x1A217
+#define GL_STRICT_SCISSOR_HINT_PGI        0x1A218
+#define GL_FULL_STIPPLE_HINT_PGI          0x1A219
+#define GL_CLIP_NEAR_HINT_PGI             0x1A220
+#define GL_CLIP_FAR_HINT_PGI              0x1A221
+#define GL_WIDE_LINE_HINT_PGI             0x1A222
+#define GL_BACK_NORMALS_HINT_PGI          0x1A223
+#endif
+
+#ifndef GL_PGI_vertex_hints
+#define GL_VERTEX_DATA_HINT_PGI           0x1A22A
+#define GL_VERTEX_CONSISTENT_HINT_PGI     0x1A22B
+#define GL_MATERIAL_SIDE_HINT_PGI         0x1A22C
+#define GL_MAX_VERTEX_HINT_PGI            0x1A22D
+#define GL_COLOR3_BIT_PGI                 0x00010000
+#define GL_COLOR4_BIT_PGI                 0x00020000
+#define GL_EDGEFLAG_BIT_PGI               0x00040000
+#define GL_INDEX_BIT_PGI                  0x00080000
+#define GL_MAT_AMBIENT_BIT_PGI            0x00100000
+#define GL_MAT_AMBIENT_AND_DIFFUSE_BIT_PGI 0x00200000
+#define GL_MAT_DIFFUSE_BIT_PGI            0x00400000
+#define GL_MAT_EMISSION_BIT_PGI           0x00800000
+#define GL_MAT_COLOR_INDEXES_BIT_PGI      0x01000000
+#define GL_MAT_SHININESS_BIT_PGI          0x02000000
+#define GL_MAT_SPECULAR_BIT_PGI           0x04000000
+#define GL_NORMAL_BIT_PGI                 0x08000000
+#define GL_TEXCOORD1_BIT_PGI              0x10000000
+#define GL_TEXCOORD2_BIT_PGI              0x20000000
+#define GL_TEXCOORD3_BIT_PGI              0x40000000
+#define GL_TEXCOORD4_BIT_PGI              0x80000000
+#define GL_VERTEX23_BIT_PGI               0x00000004
+#define GL_VERTEX4_BIT_PGI                0x00000008
+#endif
+
+#ifndef GL_REND_screen_coordinates
+#define GL_SCREEN_COORDINATES_REND        0x8490
+#define GL_INVERTED_SCREEN_W_REND         0x8491
+#endif
+
+#ifndef GL_SGI_color_matrix
+#define GL_COLOR_MATRIX_SGI               0x80B1
+#define GL_COLOR_MATRIX_STACK_DEPTH_SGI   0x80B2
+#define GL_MAX_COLOR_MATRIX_STACK_DEPTH_SGI 0x80B3
+#define GL_POST_COLOR_MATRIX_RED_SCALE_SGI 0x80B4
+#define GL_POST_COLOR_MATRIX_GREEN_SCALE_SGI 0x80B5
+#define GL_POST_COLOR_MATRIX_BLUE_SCALE_SGI 0x80B6
+#define GL_POST_COLOR_MATRIX_ALPHA_SCALE_SGI 0x80B7
+#define GL_POST_COLOR_MATRIX_RED_BIAS_SGI 0x80B8
+#define GL_POST_COLOR_MATRIX_GREEN_BIAS_SGI 0x80B9
+#define GL_POST_COLOR_MATRIX_BLUE_BIAS_SGI 0x80BA
+#define GL_POST_COLOR_MATRIX_ALPHA_BIAS_SGI 0x80BB
+#endif
+
+#ifndef GL_SGI_color_table
+#define GL_COLOR_TABLE_SGI                0x80D0
+#define GL_POST_CONVOLUTION_COLOR_TABLE_SGI 0x80D1
+#define GL_POST_COLOR_MATRIX_COLOR_TABLE_SGI 0x80D2
+#define GL_PROXY_COLOR_TABLE_SGI          0x80D3
+#define GL_PROXY_POST_CONVOLUTION_COLOR_TABLE_SGI 0x80D4
+#define GL_PROXY_POST_COLOR_MATRIX_COLOR_TABLE_SGI 0x80D5
+#define GL_COLOR_TABLE_SCALE_SGI          0x80D6
+#define GL_COLOR_TABLE_BIAS_SGI           0x80D7
+#define GL_COLOR_TABLE_FORMAT_SGI         0x80D8
+#define GL_COLOR_TABLE_WIDTH_SGI          0x80D9
+#define GL_COLOR_TABLE_RED_SIZE_SGI       0x80DA
+#define GL_COLOR_TABLE_GREEN_SIZE_SGI     0x80DB
+#define GL_COLOR_TABLE_BLUE_SIZE_SGI      0x80DC
+#define GL_COLOR_TABLE_ALPHA_SIZE_SGI     0x80DD
+#define GL_COLOR_TABLE_LUMINANCE_SIZE_SGI 0x80DE
+#define GL_COLOR_TABLE_INTENSITY_SIZE_SGI 0x80DF
+#endif
+
+#ifndef GL_SGI_texture_color_table
+#define GL_TEXTURE_COLOR_TABLE_SGI        0x80BC
+#define GL_PROXY_TEXTURE_COLOR_TABLE_SGI  0x80BD
+#endif
+
+#ifndef GL_SGIS_detail_texture
+#define GL_DETAIL_TEXTURE_2D_SGIS         0x8095
+#define GL_DETAIL_TEXTURE_2D_BINDING_SGIS 0x8096
+#define GL_LINEAR_DETAIL_SGIS             0x8097
+#define GL_LINEAR_DETAIL_ALPHA_SGIS       0x8098
+#define GL_LINEAR_DETAIL_COLOR_SGIS       0x8099
+#define GL_DETAIL_TEXTURE_LEVEL_SGIS      0x809A
+#define GL_DETAIL_TEXTURE_MODE_SGIS       0x809B
+#define GL_DETAIL_TEXTURE_FUNC_POINTS_SGIS 0x809C
+#endif
+
+#ifndef GL_SGIS_fog_function
+#define GL_FOG_FUNC_SGIS                  0x812A
+#define GL_FOG_FUNC_POINTS_SGIS           0x812B
+#define GL_MAX_FOG_FUNC_POINTS_SGIS       0x812C
+#endif
+
+#ifndef GL_SGIS_generate_mipmap
+#define GL_GENERATE_MIPMAP_SGIS           0x8191
+#define GL_GENERATE_MIPMAP_HINT_SGIS      0x8192
+#endif
+
+#ifndef GL_SGIS_multisample
+#define GL_MULTISAMPLE_SGIS               0x809D
+#define GL_SAMPLE_ALPHA_TO_MASK_SGIS      0x809E
+#define GL_SAMPLE_ALPHA_TO_ONE_SGIS       0x809F
+#define GL_SAMPLE_MASK_SGIS               0x80A0
+#define GL_1PASS_SGIS                     0x80A1
+#define GL_2PASS_0_SGIS                   0x80A2
+#define GL_2PASS_1_SGIS                   0x80A3
+#define GL_4PASS_0_SGIS                   0x80A4
+#define GL_4PASS_1_SGIS                   0x80A5
+#define GL_4PASS_2_SGIS                   0x80A6
+#define GL_4PASS_3_SGIS                   0x80A7
+#define GL_SAMPLE_BUFFERS_SGIS            0x80A8
+#define GL_SAMPLES_SGIS                   0x80A9
+#define GL_SAMPLE_MASK_VALUE_SGIS         0x80AA
+#define GL_SAMPLE_MASK_INVERT_SGIS        0x80AB
+#define GL_SAMPLE_PATTERN_SGIS            0x80AC
+#endif
+
+#ifndef GL_SGIS_pixel_texture
+#define GL_PIXEL_TEXTURE_SGIS             0x8353
+#define GL_PIXEL_FRAGMENT_RGB_SOURCE_SGIS 0x8354
+#define GL_PIXEL_FRAGMENT_ALPHA_SOURCE_SGIS 0x8355
+#define GL_PIXEL_GROUP_COLOR_SGIS         0x8356
+#endif
+
+#ifndef GL_SGIS_sharpen_texture
+#define GL_LINEAR_SHARPEN_SGIS            0x80AD
+#define GL_LINEAR_SHARPEN_ALPHA_SGIS      0x80AE
+#define GL_LINEAR_SHARPEN_COLOR_SGIS      0x80AF
+#define GL_SHARPEN_TEXTURE_FUNC_POINTS_SGIS 0x80B0
+#endif
+
+#ifndef GL_SGIS_texture_border_clamp
+#define GL_CLAMP_TO_BORDER_SGIS           0x812D
+#endif
+
+#ifndef GL_SGIS_texture_color_mask
+#define GL_TEXTURE_COLOR_WRITEMASK_SGIS   0x81EF
+#endif
+
+#ifndef GL_SGIS_texture_edge_clamp
+#define GL_CLAMP_TO_EDGE_SGIS             0x812F
+#endif
+
+#ifndef GL_SGIS_texture_filter4
+#define GL_FILTER4_SGIS                   0x8146
+#define GL_TEXTURE_FILTER4_SIZE_SGIS      0x8147
+#endif
+
+#ifndef GL_SGIS_texture_lod
+#define GL_TEXTURE_MIN_LOD_SGIS           0x813A
+#define GL_TEXTURE_MAX_LOD_SGIS           0x813B
+#define GL_TEXTURE_BASE_LEVEL_SGIS        0x813C
+#define GL_TEXTURE_MAX_LEVEL_SGIS         0x813D
+#endif
+
+#ifndef GL_SGIS_texture_select
+#define GL_DUAL_ALPHA4_SGIS               0x8110
+#define GL_DUAL_ALPHA8_SGIS               0x8111
+#define GL_DUAL_ALPHA12_SGIS              0x8112
+#define GL_DUAL_ALPHA16_SGIS              0x8113
+#define GL_DUAL_LUMINANCE4_SGIS           0x8114
+#define GL_DUAL_LUMINANCE8_SGIS           0x8115
+#define GL_DUAL_LUMINANCE12_SGIS          0x8116
+#define GL_DUAL_LUMINANCE16_SGIS          0x8117
+#define GL_DUAL_INTENSITY4_SGIS           0x8118
+#define GL_DUAL_INTENSITY8_SGIS           0x8119
+#define GL_DUAL_INTENSITY12_SGIS          0x811A
+#define GL_DUAL_INTENSITY16_SGIS          0x811B
+#define GL_DUAL_LUMINANCE_ALPHA4_SGIS     0x811C
+#define GL_DUAL_LUMINANCE_ALPHA8_SGIS     0x811D
+#define GL_QUAD_ALPHA4_SGIS               0x811E
+#define GL_QUAD_ALPHA8_SGIS               0x811F
+#define GL_QUAD_LUMINANCE4_SGIS           0x8120
+#define GL_QUAD_LUMINANCE8_SGIS           0x8121
+#define GL_QUAD_INTENSITY4_SGIS           0x8122
+#define GL_QUAD_INTENSITY8_SGIS           0x8123
+#define GL_DUAL_TEXTURE_SELECT_SGIS       0x8124
+#define GL_QUAD_TEXTURE_SELECT_SGIS       0x8125
+#endif
+
+#ifndef GL_SGIS_texture4D
+#define GL_PACK_SKIP_VOLUMES_SGIS         0x8130
+#define GL_PACK_IMAGE_DEPTH_SGIS          0x8131
+#define GL_UNPACK_SKIP_VOLUMES_SGIS       0x8132
+#define GL_UNPACK_IMAGE_DEPTH_SGIS        0x8133
+#define GL_TEXTURE_4D_SGIS                0x8134
+#define GL_PROXY_TEXTURE_4D_SGIS          0x8135
+#define GL_TEXTURE_4DSIZE_SGIS            0x8136
+#define GL_TEXTURE_WRAP_Q_SGIS            0x8137
+#define GL_MAX_4D_TEXTURE_SIZE_SGIS       0x8138
+#define GL_TEXTURE_4D_BINDING_SGIS        0x814F
+#endif
+
+#ifndef GL_SGIX_blend_alpha_minmax
+#define GL_ALPHA_MIN_SGIX                 0x8320
+#define GL_ALPHA_MAX_SGIX                 0x8321
+#endif
+
+#ifndef GL_SGIX_clipmap
+#define GL_LINEAR_CLIPMAP_LINEAR_SGIX     0x8170
+#define GL_TEXTURE_CLIPMAP_CENTER_SGIX    0x8171
+#define GL_TEXTURE_CLIPMAP_FRAME_SGIX     0x8172
+#define GL_TEXTURE_CLIPMAP_OFFSET_SGIX    0x8173
+#define GL_TEXTURE_CLIPMAP_VIRTUAL_DEPTH_SGIX 0x8174
+#define GL_TEXTURE_CLIPMAP_LOD_OFFSET_SGIX 0x8175
+#define GL_TEXTURE_CLIPMAP_DEPTH_SGIX     0x8176
+#define GL_MAX_CLIPMAP_DEPTH_SGIX         0x8177
+#define GL_MAX_CLIPMAP_VIRTUAL_DEPTH_SGIX 0x8178
+#define GL_NEAREST_CLIPMAP_NEAREST_SGIX   0x844D
+#define GL_NEAREST_CLIPMAP_LINEAR_SGIX    0x844E
+#define GL_LINEAR_CLIPMAP_NEAREST_SGIX    0x844F
+#endif
+
+#ifndef GL_SGIX_depth_texture
+#define GL_DEPTH_COMPONENT16_SGIX         0x81A5
+#define GL_DEPTH_COMPONENT24_SGIX         0x81A6
+#define GL_DEPTH_COMPONENT32_SGIX         0x81A7
+#endif
+
+#ifndef GL_SGIX_flush_raster
+#endif
+
+#ifndef GL_SGIX_fog_offset
+#define GL_FOG_OFFSET_SGIX                0x8198
+#define GL_FOG_OFFSET_VALUE_SGIX          0x8199
+#endif
+
+#ifndef GL_SGIX_framezoom
+#define GL_FRAMEZOOM_SGIX                 0x818B
+#define GL_FRAMEZOOM_FACTOR_SGIX          0x818C
+#define GL_MAX_FRAMEZOOM_FACTOR_SGIX      0x818D
+#endif
+
+#ifndef GL_SGIX_instruments
+#define GL_INSTRUMENT_BUFFER_POINTER_SGIX 0x8180
+#define GL_INSTRUMENT_MEASUREMENTS_SGIX   0x8181
+#endif
+
+#ifndef GL_SGIX_interlace
+#define GL_INTERLACE_SGIX                 0x8094
+#endif
+
+#ifndef GL_SGIX_ir_instrument1
+#define GL_IR_INSTRUMENT1_SGIX            0x817F
+#endif
+
+#ifndef GL_SGIX_list_priority
+#define GL_LIST_PRIORITY_SGIX             0x8182
+#endif
+
+#ifndef GL_SGIX_pixel_texture
+#define GL_PIXEL_TEX_GEN_SGIX             0x8139
+#define GL_PIXEL_TEX_GEN_MODE_SGIX        0x832B
+#endif
+
+#ifndef GL_SGIX_reference_plane
+#define GL_REFERENCE_PLANE_SGIX           0x817D
+#define GL_REFERENCE_PLANE_EQUATION_SGIX  0x817E
+#endif
+
+#ifndef GL_SGIX_resample
+#define GL_PACK_RESAMPLE_SGIX             0x842C
+#define GL_UNPACK_RESAMPLE_SGIX           0x842D
+#define GL_RESAMPLE_REPLICATE_SGIX        0x842E
+#define GL_RESAMPLE_ZERO_FILL_SGIX        0x842F
+#define GL_RESAMPLE_DECIMATE_SGIX         0x8430
+#endif
+
+#ifndef GL_SGIX_shadow
+#define GL_TEXTURE_COMPARE_SGIX           0x819A
+#define GL_TEXTURE_COMPARE_OPERATOR_SGIX  0x819B
+#define GL_TEXTURE_LEQUAL_R_SGIX          0x819C
+#define GL_TEXTURE_GEQUAL_R_SGIX          0x819D
+#endif
+
+#ifndef GL_SGIX_shadow_ambient
+#define GL_SHADOW_AMBIENT_SGIX            0x80BF
+#endif
+
+#ifndef GL_SGIX_sprite
+#define GL_SPRITE_SGIX                    0x8148
+#define GL_SPRITE_MODE_SGIX               0x8149
+#define GL_SPRITE_AXIS_SGIX               0x814A
+#define GL_SPRITE_TRANSLATION_SGIX        0x814B
+#define GL_SPRITE_AXIAL_SGIX              0x814C
+#define GL_SPRITE_OBJECT_ALIGNED_SGIX     0x814D
+#define GL_SPRITE_EYE_ALIGNED_SGIX        0x814E
+#endif
+
+#ifndef GL_SGIX_tag_sample_buffer
+#endif
+
+#ifndef GL_SGIX_texture_add_env
+#define GL_TEXTURE_ENV_BIAS_SGIX          0x80BE
+#endif
+
+#ifndef GL_SGIX_texture_lod_bias
+#define GL_TEXTURE_LOD_BIAS_S_SGIX        0x818E
+#define GL_TEXTURE_LOD_BIAS_T_SGIX        0x818F
+#define GL_TEXTURE_LOD_BIAS_R_SGIX        0x8190
+#endif
+
+#ifndef GL_SGIX_texture_multi_buffer
+#define GL_TEXTURE_MULTI_BUFFER_HINT_SGIX 0x812E
+#endif
+
+#ifndef GL_SGIX_texture_scale_bias
+#define GL_POST_TEXTURE_FILTER_BIAS_SGIX  0x8179
+#define GL_POST_TEXTURE_FILTER_SCALE_SGIX 0x817A
+#define GL_POST_TEXTURE_FILTER_BIAS_RANGE_SGIX 0x817B
+#define GL_POST_TEXTURE_FILTER_SCALE_RANGE_SGIX 0x817C
+#endif
+
+#ifndef GL_SGIX_vertex_preclip
+#define GL_VERTEX_PRECLIP_SGIX            0x83EE
+#define GL_VERTEX_PRECLIP_HINT_SGIX       0x83EF
+#endif
+
+#ifndef GL_SGIX_ycrcb
+#define GL_YCRCB_422_SGIX                 0x81BB
+#define GL_YCRCB_444_SGIX                 0x81BC
+#endif
+
+#ifndef GL_SUN_convolution_border_modes
+#define GL_WRAP_BORDER_SUN                0x81D4
+#endif
+
+#ifndef GL_SUN_global_alpha
+#define GL_GLOBAL_ALPHA_SUN               0x81D9
+#define GL_GLOBAL_ALPHA_FACTOR_SUN        0x81DA
+#endif
+
+#ifndef GL_SUN_triangle_list
+#define GL_RESTART_SUN                    0x01
+#define GL_REPLACE_MIDDLE_SUN             0x02
+#define GL_REPLACE_OLDEST_SUN             0x03
+#define GL_TRIANGLE_LIST_SUN              0x81D7
+#define GL_REPLACEMENT_CODE_SUN           0x81D8
+#define GL_REPLACEMENT_CODE_ARRAY_SUN     0x85C0
+#define GL_REPLACEMENT_CODE_ARRAY_TYPE_SUN 0x85C1
+#define GL_REPLACEMENT_CODE_ARRAY_STRIDE_SUN 0x85C2
+#define GL_REPLACEMENT_CODE_ARRAY_POINTER_SUN 0x85C3
+#define GL_R1UI_V3F_SUN                   0x85C4
+#define GL_R1UI_C4UB_V3F_SUN              0x85C5
+#define GL_R1UI_C3F_V3F_SUN               0x85C6
+#define GL_R1UI_N3F_V3F_SUN               0x85C7
+#define GL_R1UI_C4F_N3F_V3F_SUN           0x85C8
+#define GL_R1UI_T2F_V3F_SUN               0x85C9
+#define GL_R1UI_T2F_N3F_V3F_SUN           0x85CA
+#define GL_R1UI_T2F_C4F_N3F_V3F_SUN       0x85CB
+#endif
+
+#ifndef GL_SUN_vertex
+#endif
+
+#ifndef GL_SUNX_constant_data
+#define GL_UNPACK_CONSTANT_DATA_SUNX      0x81D5
+#define GL_TEXTURE_CONSTANT_DATA_SUNX     0x81D6
+#endif
+
+#ifndef GL_WIN_phong_shading
+#define GL_PHONG_WIN                      0x80EA
+#define GL_PHONG_HINT_WIN                 0x80EB
+#endif
+
+#ifndef GL_WIN_specular_fog
+#define GL_FOG_SPECULAR_TEXTURE_WIN       0x80EC
+#endif
+
+	/*************************************************************/
+
+#ifndef GL_VERSION_1_2
+#define GL_VERSION_1_2 1
+#ifdef GL_GLEXT_PROTOTYPES
+	extern void APIENTRY glBlendColor(GLclampf, GLclampf, GLclampf, GLclampf);
+	extern void APIENTRY glBlendEquation(GLenum);
+	extern void APIENTRY glDrawRangeElements(GLenum, GLuint, GLuint, GLsizei, GLenum, const GLvoid*);
+	extern void APIENTRY glColorTable(GLenum, GLenum, GLsizei, GLenum, GLenum, const GLvoid*);
+	extern void APIENTRY glColorTableParameterfv(GLenum, GLenum, const GLfloat*);
+	extern void APIENTRY glColorTableParameteriv(GLenum, GLenum, const GLint*);
+	extern void APIENTRY glCopyColorTable(GLenum, GLenum, GLint, GLint, GLsizei);
+	extern void APIENTRY glGetColorTable(GLenum, GLenum, GLenum, GLvoid*);
+	extern void APIENTRY glGetColorTableParameterfv(GLenum, GLenum, GLfloat*);
+	extern void APIENTRY glGetColorTableParameteriv(GLenum, GLenum, GLint*);
+	extern void APIENTRY glColorSubTable(GLenum, GLsizei, GLsizei, GLenum, GLenum, const GLvoid*);
+	extern void APIENTRY glCopyColorSubTable(GLenum, GLsizei, GLint, GLint, GLsizei);
+	extern void APIENTRY glConvolutionFilter1D(GLenum, GLenum, GLsizei, GLenum, GLenum, const GLvoid*);
+	extern void APIENTRY glConvolutionFilter2D(GLenum, GLenum, GLsizei, GLsizei, GLenum, GLenum, const GLvoid*);
+	extern void APIENTRY glConvolutionParameterf(GLenum, GLenum, GLfloat);
+	extern void APIENTRY glConvolutionParameterfv(GLenum, GLenum, const GLfloat*);
+	extern void APIENTRY glConvolutionParameteri(GLenum, GLenum, GLint);
+	extern void APIENTRY glConvolutionParameteriv(GLenum, GLenum, const GLint*);
+	extern void APIENTRY glCopyConvolutionFilter1D(GLenum, GLenum, GLint, GLint, GLsizei);
+	extern void APIENTRY glCopyConvolutionFilter2D(GLenum, GLenum, GLint, GLint, GLsizei, GLsizei);
+	extern void APIENTRY glGetConvolutionFilter(GLenum, GLenum, GLenum, GLvoid*);
+	extern void APIENTRY glGetConvolutionParameterfv(GLenum, GLenum, GLfloat*);
+	extern void APIENTRY glGetConvolutionParameteriv(GLenum, GLenum, GLint*);
+	extern void APIENTRY glGetSeparableFilter(GLenum, GLenum, GLenum, GLvoid*, GLvoid*, GLvoid*);
+	extern void APIENTRY glSeparableFilter2D(GLenum, GLenum, GLsizei, GLsizei, GLenum, GLenum, const GLvoid*, const GLvoid*);
+	extern void APIENTRY glGetHistogram(GLenum, GLboolean, GLenum, GLenum, GLvoid*);
+	extern void APIENTRY glGetHistogramParameterfv(GLenum, GLenum, GLfloat*);
+	extern void APIENTRY glGetHistogramParameteriv(GLenum, GLenum, GLint*);
+	extern void APIENTRY glGetMinmax(GLenum, GLboolean, GLenum, GLenum, GLvoid*);
+	extern void APIENTRY glGetMinmaxParameterfv(GLenum, GLenum, GLfloat*);
+	extern void APIENTRY glGetMinmaxParameteriv(GLenum, GLenum, GLint*);
+	extern void APIENTRY glHistogram(GLenum, GLsizei, GLenum, GLboolean);
+	extern void APIENTRY glMinmax(GLenum, GLenum, GLboolean);
+	extern void APIENTRY glResetHistogram(GLenum);
+	extern void APIENTRY glResetMinmax(GLenum);
+	extern void APIENTRY glTexImage3D(GLenum, GLint, GLint, GLsizei, GLsizei, GLsizei, GLint, GLenum, GLenum, const GLvoid*);
+	extern void APIENTRY glTexSubImage3D(GLenum, GLint, GLint, GLint, GLint, GLsizei, GLsizei, GLsizei, GLenum, GLenum, const GLvoid*);
+	extern void APIENTRY glCopyTexSubImage3D(GLenum, GLint, GLint, GLint, GLint, GLint, GLint, GLsizei, GLsizei);
+	extern void APIENTRY glActiveTexture(GLenum);
+	extern void APIENTRY glClientActiveTexture(GLenum);
+	extern void APIENTRY glMultiTexCoord1d(GLenum, GLdouble);
+	extern void APIENTRY glMultiTexCoord1dv(GLenum, const GLdouble*);
+	extern void APIENTRY glMultiTexCoord1f(GLenum, GLfloat);
+	extern void APIENTRY glMultiTexCoord1fv(GLenum, const GLfloat*);
+	extern void APIENTRY glMultiTexCoord1i(GLenum, GLint);
+	extern void APIENTRY glMultiTexCoord1iv(GLenum, const GLint*);
+	extern void APIENTRY glMultiTexCoord1s(GLenum, GLshort);
+	extern void APIENTRY glMultiTexCoord1sv(GLenum, const GLshort*);
+	extern void APIENTRY glMultiTexCoord2d(GLenum, GLdouble, GLdouble);
+	extern void APIENTRY glMultiTexCoord2dv(GLenum, const GLdouble*);
+	extern void APIENTRY glMultiTexCoord2f(GLenum, GLfloat, GLfloat);
+	extern void APIENTRY glMultiTexCoord2fv(GLenum, const GLfloat*);
+	extern void APIENTRY glMultiTexCoord2i(GLenum, GLint, GLint);
+	extern void APIENTRY glMultiTexCoord2iv(GLenum, const GLint*);
+	extern void APIENTRY glMultiTexCoord2s(GLenum, GLshort, GLshort);
+	extern void APIENTRY glMultiTexCoord2sv(GLenum, const GLshort*);
+	extern void APIENTRY glMultiTexCoord3d(GLenum, GLdouble, GLdouble, GLdouble);
+	extern void APIENTRY glMultiTexCoord3dv(GLenum, const GLdouble*);
+	extern void APIENTRY glMultiTexCoord3f(GLenum, GLfloat, GLfloat, GLfloat);
+	extern void APIENTRY glMultiTexCoord3fv(GLenum, const GLfloat*);
+	extern void APIENTRY glMultiTexCoord3i(GLenum, GLint, GLint, GLint);
+	extern void APIENTRY glMultiTexCoord3iv(GLenum, const GLint*);
+	extern void APIENTRY glMultiTexCoord3s(GLenum, GLshort, GLshort, GLshort);
+	extern void APIENTRY glMultiTexCoord3sv(GLenum, const GLshort*);
+	extern void APIENTRY glMultiTexCoord4d(GLenum, GLdouble, GLdouble, GLdouble, GLdouble);
+	extern void APIENTRY glMultiTexCoord4dv(GLenum, const GLdouble*);
+	extern void APIENTRY glMultiTexCoord4f(GLenum, GLfloat, GLfloat, GLfloat, GLfloat);
+	extern void APIENTRY glMultiTexCoord4fv(GLenum, const GLfloat*);
+	extern void APIENTRY glMultiTexCoord4i(GLenum, GLint, GLint, GLint, GLint);
+	extern void APIENTRY glMultiTexCoord4iv(GLenum, const GLint*);
+	extern void APIENTRY glMultiTexCoord4s(GLenum, GLshort, GLshort, GLshort, GLshort);
+	extern void APIENTRY glMultiTexCoord4sv(GLenum, const GLshort*);
+#endif /* GL_GLEXT_PROTOTYPES */
+	typedef void (APIENTRY* PFNGLBLENDCOLORPROC)(GLclampf red, GLclampf green, GLclampf blue, GLclampf alpha);
+	typedef void (APIENTRY* PFNGLBLENDEQUATIONPROC)(GLenum mode);
+	typedef void (APIENTRY* PFNGLDRAWRANGEELEMENTSPROC)(GLenum mode, GLuint start, GLuint end, GLsizei count, GLenum type, const GLvoid* indices);
+	typedef void (APIENTRY* PFNGLCOLORTABLEPROC)(GLenum target, GLenum internalformat, GLsizei width, GLenum format, GLenum type, const GLvoid* table);
+	typedef void (APIENTRY* PFNGLCOLORTABLEPARAMETERFVPROC)(GLenum target, GLenum pname, const GLfloat* params);
+	typedef void (APIENTRY* PFNGLCOLORTABLEPARAMETERIVPROC)(GLenum target, GLenum pname, const GLint* params);
+	typedef void (APIENTRY* PFNGLCOPYCOLORTABLEPROC)(GLenum target, GLenum internalformat, GLint x, GLint y, GLsizei width);
+	typedef void (APIENTRY* PFNGLGETCOLORTABLEPROC)(GLenum target, GLenum format, GLenum type, GLvoid* table);
+	typedef void (APIENTRY* PFNGLGETCOLORTABLEPARAMETERFVPROC)(GLenum target, GLenum pname, GLfloat* params);
+	typedef void (APIENTRY* PFNGLGETCOLORTABLEPARAMETERIVPROC)(GLenum target, GLenum pname, GLint* params);
+	typedef void (APIENTRY* PFNGLCOLORSUBTABLEPROC)(GLenum target, GLsizei start, GLsizei count, GLenum format, GLenum type, const GLvoid* data);
+	typedef void (APIENTRY* PFNGLCOPYCOLORSUBTABLEPROC)(GLenum target, GLsizei start, GLint x, GLint y, GLsizei width);
+	typedef void (APIENTRY* PFNGLCONVOLUTIONFILTER1DPROC)(GLenum target, GLenum internalformat, GLsizei width, GLenum format, GLenum type, const GLvoid* image);
+	typedef void (APIENTRY* PFNGLCONVOLUTIONFILTER2DPROC)(GLenum target, GLenum internalformat, GLsizei width, GLsizei height, GLenum format, GLenum type, const GLvoid* image);
+	typedef void (APIENTRY* PFNGLCONVOLUTIONPARAMETERFPROC)(GLenum target, GLenum pname, GLfloat params);
+	typedef void (APIENTRY* PFNGLCONVOLUTIONPARAMETERFVPROC)(GLenum target, GLenum pname, const GLfloat* params);
+	typedef void (APIENTRY* PFNGLCONVOLUTIONPARAMETERIPROC)(GLenum target, GLenum pname, GLint params);
+	typedef void (APIENTRY* PFNGLCONVOLUTIONPARAMETERIVPROC)(GLenum target, GLenum pname, const GLint* params);
+	typedef void (APIENTRY* PFNGLCOPYCONVOLUTIONFILTER1DPROC)(GLenum target, GLenum internalformat, GLint x, GLint y, GLsizei width);
+	typedef void (APIENTRY* PFNGLCOPYCONVOLUTIONFILTER2DPROC)(GLenum target, GLenum internalformat, GLint x, GLint y, GLsizei width, GLsizei height);
+	typedef void (APIENTRY* PFNGLGETCONVOLUTIONFILTERPROC)(GLenum target, GLenum format, GLenum type, GLvoid* image);
+	typedef void (APIENTRY* PFNGLGETCONVOLUTIONPARAMETERFVPROC)(GLenum target, GLenum pname, GLfloat* params);
+	typedef void (APIENTRY* PFNGLGETCONVOLUTIONPARAMETERIVPROC)(GLenum target, GLenum pname, GLint* params);
+	typedef void (APIENTRY* PFNGLGETSEPARABLEFILTERPROC)(GLenum target, GLenum format, GLenum type, GLvoid* row, GLvoid* column, GLvoid* span);
+	typedef void (APIENTRY* PFNGLSEPARABLEFILTER2DPROC)(GLenum target, GLenum internalformat, GLsizei width, GLsizei height, GLenum format, GLenum type, const GLvoid* row, const GLvoid* column);
+	typedef void (APIENTRY* PFNGLGETHISTOGRAMPROC)(GLenum target, GLboolean reset, GLenum format, GLenum type, GLvoid* values);
+	typedef void (APIENTRY* PFNGLGETHISTOGRAMPARAMETERFVPROC)(GLenum target, GLenum pname, GLfloat* params);
+	typedef void (APIENTRY* PFNGLGETHISTOGRAMPARAMETERIVPROC)(GLenum target, GLenum pname, GLint* params);
+	typedef void (APIENTRY* PFNGLGETMINMAXPROC)(GLenum target, GLboolean reset, GLenum format, GLenum type, GLvoid* values);
+	typedef void (APIENTRY* PFNGLGETMINMAXPARAMETERFVPROC)(GLenum target, GLenum pname, GLfloat* params);
+	typedef void (APIENTRY* PFNGLGETMINMAXPARAMETERIVPROC)(GLenum target, GLenum pname, GLint* params);
+	typedef void (APIENTRY* PFNGLHISTOGRAMPROC)(GLenum target, GLsizei width, GLenum internalformat, GLboolean sink);
+	typedef void (APIENTRY* PFNGLMINMAXPROC)(GLenum target, GLenum internalformat, GLboolean sink);
+	typedef void (APIENTRY* PFNGLRESETHISTOGRAMPROC)(GLenum target);
+	typedef void (APIENTRY* PFNGLRESETMINMAXPROC)(GLenum target);
+	typedef void (APIENTRY* PFNGLTEXIMAGE3DPROC)(GLenum target, GLint level, GLint internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLenum format, GLenum type, const GLvoid* pixels);
+	typedef void (APIENTRY* PFNGLTEXSUBIMAGE3DPROC)(GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLenum type, const GLvoid* pixels);
+	typedef void (APIENTRY* PFNGLCOPYTEXSUBIMAGE3DPROC)(GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLint x, GLint y, GLsizei width, GLsizei height);
+	typedef void (APIENTRY* PFNGLACTIVETEXTUREPROC)(GLenum texture);
+	typedef void (APIENTRY* PFNGLCLIENTACTIVETEXTUREPROC)(GLenum texture);
+	typedef void (APIENTRY* PFNGLMULTITEXCOORD1DPROC)(GLenum target, GLdouble s);
+	typedef void (APIENTRY* PFNGLMULTITEXCOORD1DVPROC)(GLenum target, const GLdouble* v);
+	typedef void (APIENTRY* PFNGLMULTITEXCOORD1FPROC)(GLenum target, GLfloat s);
+	typedef void (APIENTRY* PFNGLMULTITEXCOORD1FVPROC)(GLenum target, const GLfloat* v);
+	typedef void (APIENTRY* PFNGLMULTITEXCOORD1IPROC)(GLenum target, GLint s);
+	typedef void (APIENTRY* PFNGLMULTITEXCOORD1IVPROC)(GLenum target, const GLint* v);
+	typedef void (APIENTRY* PFNGLMULTITEXCOORD1SPROC)(GLenum target, GLshort s);
+	typedef void (APIENTRY* PFNGLMULTITEXCOORD1SVPROC)(GLenum target, const GLshort* v);
+	typedef void (APIENTRY* PFNGLMULTITEXCOORD2DPROC)(GLenum target, GLdouble s, GLdouble t);
+	typedef void (APIENTRY* PFNGLMULTITEXCOORD2DVPROC)(GLenum target, const GLdouble* v);
+	typedef void (APIENTRY* PFNGLMULTITEXCOORD2FPROC)(GLenum target, GLfloat s, GLfloat t);
+	typedef void (APIENTRY* PFNGLMULTITEXCOORD2FVPROC)(GLenum target, const GLfloat* v);
+	typedef void (APIENTRY* PFNGLMULTITEXCOORD2IPROC)(GLenum target, GLint s, GLint t);
+	typedef void (APIENTRY* PFNGLMULTITEXCOORD2IVPROC)(GLenum target, const GLint* v);
+	typedef void (APIENTRY* PFNGLMULTITEXCOORD2SPROC)(GLenum target, GLshort s, GLshort t);
+	typedef void (APIENTRY* PFNGLMULTITEXCOORD2SVPROC)(GLenum target, const GLshort* v);
+	typedef void (APIENTRY* PFNGLMULTITEXCOORD3DPROC)(GLenum target, GLdouble s, GLdouble t, GLdouble r);
+	typedef void (APIENTRY* PFNGLMULTITEXCOORD3DVPROC)(GLenum target, const GLdouble* v);
+	typedef void (APIENTRY* PFNGLMULTITEXCOORD3FPROC)(GLenum target, GLfloat s, GLfloat t, GLfloat r);
+	typedef void (APIENTRY* PFNGLMULTITEXCOORD3FVPROC)(GLenum target, const GLfloat* v);
+	typedef void (APIENTRY* PFNGLMULTITEXCOORD3IPROC)(GLenum target, GLint s, GLint t, GLint r);
+	typedef void (APIENTRY* PFNGLMULTITEXCOORD3IVPROC)(GLenum target, const GLint* v);
+	typedef void (APIENTRY* PFNGLMULTITEXCOORD3SPROC)(GLenum target, GLshort s, GLshort t, GLshort r);
+	typedef void (APIENTRY* PFNGLMULTITEXCOORD3SVPROC)(GLenum target, const GLshort* v);
+	typedef void (APIENTRY* PFNGLMULTITEXCOORD4DPROC)(GLenum target, GLdouble s, GLdouble t, GLdouble r, GLdouble q);
+	typedef void (APIENTRY* PFNGLMULTITEXCOORD4DVPROC)(GLenum target, const GLdouble* v);
+	typedef void (APIENTRY* PFNGLMULTITEXCOORD4FPROC)(GLenum target, GLfloat s, GLfloat t, GLfloat r, GLfloat q);
+	typedef void (APIENTRY* PFNGLMULTITEXCOORD4FVPROC)(GLenum target, const GLfloat* v);
+	typedef void (APIENTRY* PFNGLMULTITEXCOORD4IPROC)(GLenum target, GLint s, GLint t, GLint r, GLint q);
+	typedef void (APIENTRY* PFNGLMULTITEXCOORD4IVPROC)(GLenum target, const GLint* v);
+	typedef void (APIENTRY* PFNGLMULTITEXCOORD4SPROC)(GLenum target, GLshort s, GLshort t, GLshort r, GLshort q);
+	typedef void (APIENTRY* PFNGLMULTITEXCOORD4SVPROC)(GLenum target, const GLshort* v);
+#endif
+
+#ifndef GL_VERSION_1_3
+#define GL_VERSION_1_3 1
+#ifdef GL_GLEXT_PROTOTYPES
+	extern void APIENTRY glCompressedTexImage3D(GLenum, GLint, GLenum, GLsizei, GLsizei, GLsizei, GLint, GLsizei, const GLvoid*);
+	extern void APIENTRY glCompressedTexImage2D(GLenum, GLint, GLenum, GLsizei, GLsizei, GLint, GLsizei, const GLvoid*);
+	extern void APIENTRY glCompressedTexImage1D(GLenum, GLint, GLenum, GLsizei, GLint, GLsizei, const GLvoid*);
+	extern void APIENTRY glCompressedTexSubImage3D(GLenum, GLint, GLint, GLint, GLint, GLsizei, GLsizei, GLsizei, GLenum, GLsizei, const GLvoid*);
+	extern void APIENTRY glCompressedTexSubImage2D(GLenum, GLint, GLint, GLint, GLsizei, GLsizei, GLenum, GLsizei, const GLvoid*);
+	extern void APIENTRY glCompressedTexSubImage1D(GLenum, GLint, GLint, GLsizei, GLenum, GLsizei, const GLvoid*);
+	extern void APIENTRY glGetCompressedTexImage(GLenum, GLint, void*);
+	extern void APIENTRY glSampleCoverage(GLclampf, GLboolean);
+	extern void APIENTRY glLoadTransposeMatrixf(const GLfloat*);
+	extern void APIENTRY glLoadTransposeMatrixd(const GLdouble*);
+	extern void APIENTRY glMultTransposeMatrixf(const GLfloat*);
+	extern void APIENTRY glMultTransposeMatrixd(const GLdouble*);
+#endif /* GL_GLEXT_PROTOTYPES */
+	typedef void (APIENTRY* PFNGLCOMPRESSEDTEXIMAGE3DPROC)(GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLsizei imageSize, const GLvoid* data);
+	typedef void (APIENTRY* PFNGLCOMPRESSEDTEXIMAGE2DPROC)(GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLint border, GLsizei imageSize, const GLvoid* data);
+	typedef void (APIENTRY* PFNGLCOMPRESSEDTEXIMAGE1DPROC)(GLenum target, GLint level, GLenum internalformat, GLsizei width, GLint border, GLsizei imageSize, const GLvoid* data);
+	typedef void (APIENTRY* PFNGLCOMPRESSEDTEXSUBIMAGE3DPROC)(GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLsizei imageSize, const GLvoid* data);
+	typedef void (APIENTRY* PFNGLCOMPRESSEDTEXSUBIMAGE2DPROC)(GLenum target, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLsizei imageSize, const GLvoid* data);
+	typedef void (APIENTRY* PFNGLCOMPRESSEDTEXSUBIMAGE1DPROC)(GLenum target, GLint level, GLint xoffset, GLsizei width, GLenum format, GLsizei imageSize, const GLvoid* data);
+	typedef void (APIENTRY* PFNGLGETCOMPRESSEDTEXIMAGEPROC)(GLenum target, GLint level, void* img);
+	typedef void (APIENTRY* PFNGLSAMPLECOVERAGEPROC)(GLclampf value, GLboolean invert);
+	typedef void (APIENTRY* PFNGLLOADTRANSPOSEMATRIXFPROC)(const GLfloat* m);
+	typedef void (APIENTRY* PFNGLLOADTRANSPOSEMATRIXDPROC)(const GLdouble* m);
+	typedef void (APIENTRY* PFNGLMULTTRANSPOSEMATRIXFPROC)(const GLfloat* m);
+	typedef void (APIENTRY* PFNGLMULTTRANSPOSEMATRIXDPROC)(const GLdouble* m);
+#endif
+
+#ifndef GL_VERSION_1_4
+#define GL_VERSION_1_4 1
+#ifdef GL_GLEXT_PROTOTYPES
+	extern void APIENTRY glMultiDrawArrays(GLenum, GLint*, GLsizei*, GLsizei);
+	extern void APIENTRY glMultiDrawElements(GLenum, const GLsizei*, GLenum, const GLvoid**, GLsizei);
+	extern void APIENTRY glPointParameterf(GLenum pname, GLfloat param);
+	extern void APIENTRY glPointParameterfv(GLenum pname, GLfloat* params);
+	extern void APIENTRY glSecondaryColor3b(GLbyte, GLbyte, GLbyte);
+	extern void APIENTRY glSecondaryColor3bv(const GLbyte*);
+	extern void APIENTRY glSecondaryColor3d(GLdouble, GLdouble, GLdouble);
+	extern void APIENTRY glSecondaryColor3dv(const GLdouble*);
+	extern void APIENTRY glSecondaryColor3f(GLfloat, GLfloat, GLfloat);
+	extern void APIENTRY glSecondaryColor3fv(const GLfloat*);
+	extern void APIENTRY glSecondaryColor3i(GLint, GLint, GLint);
+	extern void APIENTRY glSecondaryColor3iv(const GLint*);
+	extern void APIENTRY glSecondaryColor3s(GLshort, GLshort, GLshort);
+	extern void APIENTRY glSecondaryColor3sv(const GLshort*);
+	extern void APIENTRY glSecondaryColor3ub(GLubyte, GLubyte, GLubyte);
+	extern void APIENTRY glSecondaryColor3ubv(const GLubyte*);
+	extern void APIENTRY glSecondaryColor3ui(GLuint, GLuint, GLuint);
+	extern void APIENTRY glSecondaryColor3uiv(const GLuint*);
+	extern void APIENTRY glSecondaryColor3us(GLushort, GLushort, GLushort);
+	extern void APIENTRY glSecondaryColor3usv(const GLushort*);
+	extern void APIENTRY glSecondaryColorPointer(GLint, GLenum, GLsizei, GLvoid*);
+	extern void APIENTRY glBlendFuncSeparate(GLenum, GLenum, GLenum, GLenum);
+	extern void APIENTRY glWindowPos2d(GLdouble x, GLdouble y);
+	extern void APIENTRY glWindowPos2f(GLfloat x, GLfloat y);
+	extern void APIENTRY glWindowPos2i(GLint x, GLint y);
+	extern void APIENTRY glWindowPos2s(GLshort x, GLshort y);
+	extern void APIENTRY glWindowPos2dv(const GLdouble* p);
+	extern void APIENTRY glWindowPos2fv(const GLfloat* p);
+	extern void APIENTRY glWindowPos2iv(const GLint* p);
+	extern void APIENTRY glWindowPos2sv(const GLshort* p);
+	extern void APIENTRY glWindowPos3d(GLdouble x, GLdouble y, GLdouble z);
+	extern void APIENTRY glWindowPos3f(GLfloat x, GLfloat y, GLfloat z);
+	extern void APIENTRY glWindowPos3i(GLint x, GLint y, GLint z);
+	extern void APIENTRY glWindowPos3s(GLshort x, GLshort y, GLshort z);
+	extern void APIENTRY glWindowPos3dv(const GLdouble* p);
+	extern void APIENTRY glWindowPos3fv(const GLfloat* p);
+	extern void APIENTRY glWindowPos3iv(const GLint* p);
+	extern void APIENTRY glWindowPos3sv(const GLshort* p);
+#endif /* GL_GLEXT_PROTOTYPES */
+	typedef void (APIENTRY* PFNGLMULTIDRAWARRAYSPROC)(GLenum mode, GLint* first, GLsizei* count, GLsizei primcount);
+	typedef void (APIENTRY* PFNGLMULTIDRAWELEMENTSPROC)(GLenum mode, const GLsizei* count, GLenum type, const GLvoid* *indices, GLsizei primcount);
+	typedef void (APIENTRY* PFNGLPOINTPARAMETERFPROC)(GLenum pname, GLfloat param);
+	typedef void (APIENTRY* PFNGLPOINTPARAMETERFVPROC)(GLenum pname, GLfloat* params);
+	typedef void (APIENTRY* PFNGLSECONDARYCOLOR3BPROC)(GLbyte red, GLbyte green, GLbyte blue);
+	typedef void (APIENTRY* PFNGLSECONDARYCOLOR3BVPROC)(const GLbyte* v);
+	typedef void (APIENTRY* PFNGLSECONDARYCOLOR3DPROC)(GLdouble red, GLdouble green, GLdouble blue);
+	typedef void (APIENTRY* PFNGLSECONDARYCOLOR3DVPROC)(const GLdouble* v);
+	typedef void (APIENTRY* PFNGLSECONDARYCOLOR3FPROC)(GLfloat red, GLfloat green, GLfloat blue);
+	typedef void (APIENTRY* PFNGLSECONDARYCOLOR3FVPROC)(const GLfloat* v);
+	typedef void (APIENTRY* PFNGLSECONDARYCOLOR3IPROC)(GLint red, GLint green, GLint blue);
+	typedef void (APIENTRY* PFNGLSECONDARYCOLOR3IVPROC)(const GLint* v);
+	typedef void (APIENTRY* PFNGLSECONDARYCOLOR3SPROC)(GLshort red, GLshort green, GLshort blue);
+	typedef void (APIENTRY* PFNGLSECONDARYCOLOR3SVPROC)(const GLshort* v);
+	typedef void (APIENTRY* PFNGLSECONDARYCOLOR3UBPROC)(GLubyte red, GLubyte green, GLubyte blue);
+	typedef void (APIENTRY* PFNGLSECONDARYCOLOR3UBVPROC)(const GLubyte* v);
+	typedef void (APIENTRY* PFNGLSECONDARYCOLOR3UIPROC)(GLuint red, GLuint green, GLuint blue);
+	typedef void (APIENTRY* PFNGLSECONDARYCOLOR3UIVPROC)(const GLuint* v);
+	typedef void (APIENTRY* PFNGLSECONDARYCOLOR3USPROC)(GLushort red, GLushort green, GLushort blue);
+	typedef void (APIENTRY* PFNGLSECONDARYCOLOR3USVPROC)(const GLushort* v);
+	typedef void (APIENTRY* PFNGLSECONDARYCOLORPOINTERPROC)(GLint size, GLenum type, GLsizei stride, GLvoid* pointer);
+	typedef void (APIENTRY* PFNGLBLENDFUNCSEPARATEPROC)(GLenum sfactorRGB, GLenum dfactorRGB, GLenum sfactorAlpha, GLenum dfactorAlpha);
+	typedef void (APIENTRY* PFNGLWINDOWPOS2DPROC)(GLdouble x, GLdouble y);
+	typedef void (APIENTRY* PFNGLWINDOWPOS2FPROC)(GLfloat x, GLfloat y);
+	typedef void (APIENTRY* PFNGLWINDOWPOS2IPROC)(GLint x, GLint y);
+	typedef void (APIENTRY* PFNGLWINDOWPOS2SPROC)(GLshort x, GLshort y);
+	typedef void (APIENTRY* PFNGLWINDOWPOS2DVPROC)(const GLdouble* p);
+	typedef void (APIENTRY* PFNGLWINDOWPOS2FVPROC)(const GLfloat* p);
+	typedef void (APIENTRY* PFNGLWINDOWPOS2IVPROC)(const GLint* p);
+	typedef void (APIENTRY* PFNGLWINDOWPOS2SVPROC)(const GLshort* p);
+	typedef void (APIENTRY* PFNGLWINDOWPOS3DPROC)(GLdouble x, GLdouble y, GLdouble z);
+	typedef void (APIENTRY* PFNGLWINDOWPOS3FPROC)(GLfloat x, GLfloat y, GLfloat z);
+	typedef void (APIENTRY* PFNGLWINDOWPOS3IPROC)(GLint x, GLint y, GLint z);
+	typedef void (APIENTRY* PFNGLWINDOWPOS3SPROC)(GLshort x, GLshort y, GLshort z);
+	typedef void (APIENTRY* PFNGLWINDOWPOS3DVPROC)(const GLdouble* p);
+	typedef void (APIENTRY* PFNGLWINDOWPOS3FVPROC)(const GLfloat* p);
+	typedef void (APIENTRY* PFNGLWINDOWPOS3IVPROC)(const GLint* p);
+	typedef void (APIENTRY* PFNGLWINDOWPOS3SVPROC)(const GLshort* p);
+#endif
+
+
+#ifndef GL_ARB_depth_texture
+#define GL_ARB_depth_texture 1
+#endif
+
+#ifndef GL_ARB_fragment_program
+#define GL_ARB_fragment_program 1
+#endif
+
+
+#ifndef GL_ARB_multisample
+#define GL_ARB_multisample 1
+#ifdef GL_GLEXT_PROTOTYPES
+	extern void APIENTRY glSampleCoverageARB(GLclampf, GLboolean);
+#endif /* GL_GLEXT_PROTOTYPES */
+	typedef void (APIENTRY* PFNGLSAMPLECOVERAGEARBPROC)(GLclampf value, GLboolean invert);
+#endif
+
+#ifndef GL_ARB_multitexture
+#define GL_ARB_multitexture 1
+#ifdef GL_GLEXT_PROTOTYPES
+	extern void APIENTRY glActiveTextureARB(GLenum);
+	extern void APIENTRY glClientActiveTextureARB(GLenum);
+	extern void APIENTRY glMultiTexCoord1dARB(GLenum, GLdouble);
+	extern void APIENTRY glMultiTexCoord1dvARB(GLenum, const GLdouble*);
+	extern void APIENTRY glMultiTexCoord1fARB(GLenum, GLfloat);
+	extern void APIENTRY glMultiTexCoord1fvARB(GLenum, const GLfloat*);
+	extern void APIENTRY glMultiTexCoord1iARB(GLenum, GLint);
+	extern void APIENTRY glMultiTexCoord1ivARB(GLenum, const GLint*);
+	extern void APIENTRY glMultiTexCoord1sARB(GLenum, GLshort);
+	extern void APIENTRY glMultiTexCoord1svARB(GLenum, const GLshort*);
+	extern void APIENTRY glMultiTexCoord2dARB(GLenum, GLdouble, GLdouble);
+	extern void APIENTRY glMultiTexCoord2dvARB(GLenum, const GLdouble*);
+	extern void APIENTRY glMultiTexCoord2fARB(GLenum, GLfloat, GLfloat);
+	extern void APIENTRY glMultiTexCoord2fvARB(GLenum, const GLfloat*);
+	extern void APIENTRY glMultiTexCoord2iARB(GLenum, GLint, GLint);
+	extern void APIENTRY glMultiTexCoord2ivARB(GLenum, const GLint*);
+	extern void APIENTRY glMultiTexCoord2sARB(GLenum, GLshort, GLshort);
+	extern void APIENTRY glMultiTexCoord2svARB(GLenum, const GLshort*);
+	extern void APIENTRY glMultiTexCoord3dARB(GLenum, GLdouble, GLdouble, GLdouble);
+	extern void APIENTRY glMultiTexCoord3dvARB(GLenum, const GLdouble*);
+	extern void APIENTRY glMultiTexCoord3fARB(GLenum, GLfloat, GLfloat, GLfloat);
+	extern void APIENTRY glMultiTexCoord3fvARB(GLenum, const GLfloat*);
+	extern void APIENTRY glMultiTexCoord3iARB(GLenum, GLint, GLint, GLint);
+	extern void APIENTRY glMultiTexCoord3ivARB(GLenum, const GLint*);
+	extern void APIENTRY glMultiTexCoord3sARB(GLenum, GLshort, GLshort, GLshort);
+	extern void APIENTRY glMultiTexCoord3svARB(GLenum, const GLshort*);
+	extern void APIENTRY glMultiTexCoord4dARB(GLenum, GLdouble, GLdouble, GLdouble, GLdouble);
+	extern void APIENTRY glMultiTexCoord4dvARB(GLenum, const GLdouble*);
+	extern void APIENTRY glMultiTexCoord4fARB(GLenum, GLfloat, GLfloat, GLfloat, GLfloat);
+	extern void APIENTRY glMultiTexCoord4fvARB(GLenum, const GLfloat*);
+	extern void APIENTRY glMultiTexCoord4iARB(GLenum, GLint, GLint, GLint, GLint);
+	extern void APIENTRY glMultiTexCoord4ivARB(GLenum, const GLint*);
+	extern void APIENTRY glMultiTexCoord4sARB(GLenum, GLshort, GLshort, GLshort, GLshort);
+	extern void APIENTRY glMultiTexCoord4svARB(GLenum, const GLshort*);
+#endif /* GL_GLEXT_PROTOTYPES */
+	typedef void (APIENTRY* PFNGLACTIVETEXTUREARBPROC)(GLenum texture);
+	typedef void (APIENTRY* PFNGLCLIENTACTIVETEXTUREARBPROC)(GLenum texture);
+	typedef void (APIENTRY* PFNGLMULTITEXCOORD1DARBPROC)(GLenum target, GLdouble s);
+	typedef void (APIENTRY* PFNGLMULTITEXCOORD1DVARBPROC)(GLenum target, const GLdouble* v);
+	typedef void (APIENTRY* PFNGLMULTITEXCOORD1FARBPROC)(GLenum target, GLfloat s);
+	typedef void (APIENTRY* PFNGLMULTITEXCOORD1FVARBPROC)(GLenum target, const GLfloat* v);
+	typedef void (APIENTRY* PFNGLMULTITEXCOORD1IARBPROC)(GLenum target, GLint s);
+	typedef void (APIENTRY* PFNGLMULTITEXCOORD1IVARBPROC)(GLenum target, const GLint* v);
+	typedef void (APIENTRY* PFNGLMULTITEXCOORD1SARBPROC)(GLenum target, GLshort s);
+	typedef void (APIENTRY* PFNGLMULTITEXCOORD1SVARBPROC)(GLenum target, const GLshort* v);
+	typedef void (APIENTRY* PFNGLMULTITEXCOORD2DARBPROC)(GLenum target, GLdouble s, GLdouble t);
+	typedef void (APIENTRY* PFNGLMULTITEXCOORD2DVARBPROC)(GLenum target, const GLdouble* v);
+	typedef void (APIENTRY* PFNGLMULTITEXCOORD2FARBPROC)(GLenum target, GLfloat s, GLfloat t);
+	typedef void (APIENTRY* PFNGLMULTITEXCOORD2FVARBPROC)(GLenum target, const GLfloat* v);
+	typedef void (APIENTRY* PFNGLMULTITEXCOORD2IARBPROC)(GLenum target, GLint s, GLint t);
+	typedef void (APIENTRY* PFNGLMULTITEXCOORD2IVARBPROC)(GLenum target, const GLint* v);
+	typedef void (APIENTRY* PFNGLMULTITEXCOORD2SARBPROC)(GLenum target, GLshort s, GLshort t);
+	typedef void (APIENTRY* PFNGLMULTITEXCOORD2SVARBPROC)(GLenum target, const GLshort* v);
+	typedef void (APIENTRY* PFNGLMULTITEXCOORD3DARBPROC)(GLenum target, GLdouble s, GLdouble t, GLdouble r);
+	typedef void (APIENTRY* PFNGLMULTITEXCOORD3DVARBPROC)(GLenum target, const GLdouble* v);
+	typedef void (APIENTRY* PFNGLMULTITEXCOORD3FARBPROC)(GLenum target, GLfloat s, GLfloat t, GLfloat r);
+	typedef void (APIENTRY* PFNGLMULTITEXCOORD3FVARBPROC)(GLenum target, const GLfloat* v);
+	typedef void (APIENTRY* PFNGLMULTITEXCOORD3IARBPROC)(GLenum target, GLint s, GLint t, GLint r);
+	typedef void (APIENTRY* PFNGLMULTITEXCOORD3IVARBPROC)(GLenum target, const GLint* v);
+	typedef void (APIENTRY* PFNGLMULTITEXCOORD3SARBPROC)(GLenum target, GLshort s, GLshort t, GLshort r);
+	typedef void (APIENTRY* PFNGLMULTITEXCOORD3SVARBPROC)(GLenum target, const GLshort* v);
+	typedef void (APIENTRY* PFNGLMULTITEXCOORD4DARBPROC)(GLenum target, GLdouble s, GLdouble t, GLdouble r, GLdouble q);
+	typedef void (APIENTRY* PFNGLMULTITEXCOORD4DVARBPROC)(GLenum target, const GLdouble* v);
+	typedef void (APIENTRY* PFNGLMULTITEXCOORD4FARBPROC)(GLenum target, GLfloat s, GLfloat t, GLfloat r, GLfloat q);
+	typedef void (APIENTRY* PFNGLMULTITEXCOORD4FVARBPROC)(GLenum target, const GLfloat* v);
+	typedef void (APIENTRY* PFNGLMULTITEXCOORD4IARBPROC)(GLenum target, GLint s, GLint t, GLint r, GLint q);
+	typedef void (APIENTRY* PFNGLMULTITEXCOORD4IVARBPROC)(GLenum target, const GLint* v);
+	typedef void (APIENTRY* PFNGLMULTITEXCOORD4SARBPROC)(GLenum target, GLshort s, GLshort t, GLshort r, GLshort q);
+	typedef void (APIENTRY* PFNGLMULTITEXCOORD4SVARBPROC)(GLenum target, const GLshort* v);
+#endif
+
+#ifndef GL_ARB_point_parameters
+#define GL_ARB_point_parameters 1
+#ifdef GL_GLEXT_PROTOTYPES
+	extern void APIENTRY glPointParameterfARB(GLenum pname, GLfloat param);
+	extern void APIENTRY glPointParameterfvARB(GLenum pname, GLfloat* params);
+#endif
+	typedef void (APIENTRY* PFNGLPOINTPARAMETERFARBPROC)(GLenum pname, GLfloat param);
+	typedef void (APIENTRY* PFNGLPOINTPARAMETERFVARBPROC)(GLenum pname, GLfloat* params);
+#endif
+
+#ifndef GL_ARB_shadow
+#define GL_ARB_shadow 1
+#endif
+
+#ifndef GL_ARB_texture_border_clamp
+#define GL_ARB_texture_border_clamp 1
+#endif
+
+#ifndef GL_ARB_texture_compression
+#define GL_ARB_texture_compression 1
+#ifdef GL_GLEXT_PROTOTYPES
+	extern void APIENTRY glCompressedTexImage3DARB(GLenum, GLint, GLenum, GLsizei, GLsizei, GLsizei, GLint, GLsizei, const GLvoid*);
+	extern void APIENTRY glCompressedTexImage2DARB(GLenum, GLint, GLenum, GLsizei, GLsizei, GLint, GLsizei, const GLvoid*);
+	extern void APIENTRY glCompressedTexImage1DARB(GLenum, GLint, GLenum, GLsizei, GLint, GLsizei, const GLvoid*);
+	extern void APIENTRY glCompressedTexSubImage3DARB(GLenum, GLint, GLint, GLint, GLint, GLsizei, GLsizei, GLsizei, GLenum, GLsizei, const GLvoid*);
+	extern void APIENTRY glCompressedTexSubImage2DARB(GLenum, GLint, GLint, GLint, GLsizei, GLsizei, GLenum, GLsizei, const GLvoid*);
+	extern void APIENTRY glCompressedTexSubImage1DARB(GLenum, GLint, GLint, GLsizei, GLenum, GLsizei, const GLvoid*);
+	extern void APIENTRY glGetCompressedTexImageARB(GLenum, GLint, void*);
+#endif /* GL_GLEXT_PROTOTYPES */
+	typedef void (APIENTRY* PFNGLCOMPRESSEDTEXIMAGE3DARBPROC)(GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLsizei imageSize, const GLvoid* data);
+	typedef void (APIENTRY* PFNGLCOMPRESSEDTEXIMAGE2DARBPROC)(GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLint border, GLsizei imageSize, const GLvoid* data);
+	typedef void (APIENTRY* PFNGLCOMPRESSEDTEXIMAGE1DARBPROC)(GLenum target, GLint level, GLenum internalformat, GLsizei width, GLint border, GLsizei imageSize, const GLvoid* data);
+	typedef void (APIENTRY* PFNGLCOMPRESSEDTEXSUBIMAGE3DARBPROC)(GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLsizei imageSize, const GLvoid* data);
+	typedef void (APIENTRY* PFNGLCOMPRESSEDTEXSUBIMAGE2DARBPROC)(GLenum target, GLint level, GLint xoffset, GLint yoffset, GLsizei width, GLsizei height, GLenum format, GLsizei imageSize, const GLvoid* data);
+	typedef void (APIENTRY* PFNGLCOMPRESSEDTEXSUBIMAGE1DARBPROC)(GLenum target, GLint level, GLint xoffset, GLsizei width, GLenum format, GLsizei imageSize, const GLvoid* data);
+	typedef void (APIENTRY* PFNGLGETCOMPRESSEDTEXIMAGEARBPROC)(GLenum target, GLint level, void* img);
+#endif
+
+#ifndef GL_ARB_texture_cube_map
+#define GL_ARB_texture_cube_map 1
+#endif
+
+#ifndef GL_ARB_texture_env_add
+#define GL_ARB_texture_env_add 1
+#endif
+
+#ifndef GL_ARB_texture_env_combine
+#define GL_ARB_texture_env_combine 1
+#endif
+
+#ifndef GL_ARB_texture_env_dot3
+#define GL_ARB_texture_env_dot3 1
+#endif
+
+#ifndef GL_ARB_texture_mirrored_repeat
+#define GL_ARB_texture_mirrored_repeat 1
+#endif
+
+#ifndef GL_ARB_transpose_matrix
+#define GL_ARB_transpose_matrix 1
+#ifdef GL_GLEXT_PROTOTYPES
+	extern void APIENTRY glLoadTransposeMatrixfARB(const GLfloat*);
+	extern void APIENTRY glLoadTransposeMatrixdARB(const GLdouble*);
+	extern void APIENTRY glMultTransposeMatrixfARB(const GLfloat*);
+	extern void APIENTRY glMultTransposeMatrixdARB(const GLdouble*);
+#endif /* GL_GLEXT_PROTOTYPES */
+	typedef void (APIENTRY* PFNGLLOADTRANSPOSEMATRIXFARBPROC)(const GLfloat* m);
+	typedef void (APIENTRY* PFNGLLOADTRANSPOSEMATRIXDARBPROC)(const GLdouble* m);
+	typedef void (APIENTRY* PFNGLMULTTRANSPOSEMATRIXFARBPROC)(const GLfloat* m);
+	typedef void (APIENTRY* PFNGLMULTTRANSPOSEMATRIXDARBPROC)(const GLdouble* m);
+#endif
+
+#ifndef GL_ARB_vertex_buffer_object
+#define GL_ARB_vertex_buffer_object 1
+#if defined(_WIN64)
+	typedef __int64 GLintptrARB;
+	typedef __int64 GLsizeiptrARB;
+#elif defined(__ia64__) || defined(__x86_64__)
+	typedef long int GLintptrARB;
+	typedef long int GLsizeiptrARB;
+#else
+	typedef int GLintptrARB;
+	typedef int GLsizeiptrARB;
+#endif
+#ifdef GL_GLEXT_PROTOTYPES
+	extern void APIENTRY glBindBufferARB(GLenum target, GLuint buffer);
+	extern void APIENTRY glDeleteBuffersARB(GLsizei n, const GLuint* buffers);
+	extern void APIENTRY glGenBuffersARB(GLsizei n, GLuint* buffers);
+	extern GLboolean APIENTRY glIsBufferARB(GLuint buffer);
+	extern void APIENTRY glBufferDataARB(GLenum target, GLsizeiptrARB size, const GLvoid* data, GLenum usage);
+	extern void APIENTRY glBufferSubDataARB(GLenum target, GLintptrARB offset, GLsizeiptrARB size, const GLvoid* data);
+	extern void APIENTRY glGetBufferSubDataARB(GLenum target, GLintptrARB offset, GLsizeiptrARB size, GLvoid* data);
+	extern void* APIENTRY glMapBufferARB(GLenum target, GLenum access);
+	extern GLboolean APIENTRY glUnmapBufferARB(GLenum target);
+	extern void APIENTRY glGetBufferParameterivARB(GLenum target, GLenum pname, GLint* params);
+	extern void APIENTRY glGetBufferPointervARB(GLenum target, GLenum pname, GLvoid** params);
+#endif
+	typedef void (APIENTRY* PFNGLBINDBUFFERARBPROC)(GLenum target, GLuint buffer);
+	typedef void (APIENTRY* PFNGLDELETEBUFFERSARBPROC)(GLsizei n, const GLuint* buffers);
+	typedef void (APIENTRY* PFNGLGENBUFFERSARBPROC)(GLsizei n, GLuint* buffers);
+	typedef GLboolean(APIENTRY* PFNGLISBUFFERARBPROC)(GLuint buffer);
+	typedef void (APIENTRY* PFNGLBUFFERDATAARBPROC)(GLenum target, GLsizeiptrARB size, const GLvoid* data, GLenum usage);
+	typedef void (APIENTRY* PFNGLBUFFERSUBDATAARBPROC)(GLenum target, GLintptrARB offset, GLsizeiptrARB size, const GLvoid* data);
+	typedef void (APIENTRY* PFNGLGETBUFFERSUBDATAARBPROC)(GLenum target, GLintptrARB offset, GLsizeiptrARB size, GLvoid* data);
+	typedef void* (APIENTRY* PFNGLMAPBUFFERARBPROC)(GLenum target, GLenum access);
+	typedef GLboolean(APIENTRY* PFNGLUNMAPBUFFERARBPROC)(GLenum target);
+	typedef void (APIENTRY* PFNGLGETBUFFERPARAMETERIVARBPROC)(GLenum target, GLenum pname, GLint* params);
+	typedef void (APIENTRY* PFNGLGETBUFFERPOINTERVARBPROC)(GLenum target, GLenum pname, GLvoid** params);
+#endif
+
+#ifndef GL_ARB_vertex_program
+#define GL_ARB_vertex_program 1
+#ifdef GL_GLEXT_PROTOTYPES
+	extern void APIENTRY glVertexAttrib1sARB(GLuint index, GLshort x);
+	extern void APIENTRY glVertexAttrib1fARB(GLuint index, GLfloat x);
+	extern void APIENTRY glVertexAttrib1dARB(GLuint index, GLdouble x);
+	extern void APIENTRY glVertexAttrib2sARB(GLuint index, GLshort x, GLshort y);
+	extern void APIENTRY glVertexAttrib2fARB(GLuint index, GLfloat x, GLfloat y);
+	extern void APIENTRY glVertexAttrib2dARB(GLuint index, GLdouble x, GLdouble y);
+	extern void APIENTRY glVertexAttrib3sARB(GLuint index, GLshort x, GLshort y, GLshort z);
+	extern void APIENTRY glVertexAttrib3fARB(GLuint index, GLfloat x, GLfloat y, GLfloat z);
+	extern void APIENTRY glVertexAttrib3dARB(GLuint index, GLdouble x, GLdouble y, GLdouble z);
+	extern void APIENTRY glVertexAttrib4sARB(GLuint index, GLshort x, GLshort y, GLshort z, GLshort w);
+	extern void APIENTRY glVertexAttrib4fARB(GLuint index, GLfloat x, GLfloat y, GLfloat z, GLfloat w);
+	extern void APIENTRY glVertexAttrib4dARB(GLuint index, GLdouble x, GLdouble y, GLdouble z, GLdouble w);
+	extern void APIENTRY glVertexAttrib4NubARB(GLuint index, GLubyte x, GLubyte y, GLubyte z, GLubyte w);
+	extern void APIENTRY glVertexAttrib1svARB(GLuint index, const GLshort* v);
+	extern void APIENTRY glVertexAttrib1fvARB(GLuint index, const GLfloat* v);
+	extern void APIENTRY glVertexAttrib1dvARB(GLuint index, const GLdouble* v);
+	extern void APIENTRY glVertexAttrib2svARB(GLuint index, const GLshort* v);
+	extern void APIENTRY glVertexAttrib2fvARB(GLuint index, const GLfloat* v);
+	extern void APIENTRY glVertexAttrib2dvARB(GLuint index, const GLdouble* v);
+	extern void APIENTRY glVertexAttrib3svARB(GLuint index, const GLshort* v);
+	extern void APIENTRY glVertexAttrib3fvARB(GLuint index, const GLfloat* v);
+	extern void APIENTRY glVertexAttrib3dvARB(GLuint index, const GLdouble* v);
+	extern void APIENTRY glVertexAttrib4bvARB(GLuint index, const GLbyte* v);
+	extern void APIENTRY glVertexAttrib4svARB(GLuint index, const GLshort* v);
+	extern void APIENTRY glVertexAttrib4ivARB(GLuint index, const GLint* v);
+	extern void APIENTRY glVertexAttrib4ubvARB(GLuint index, const GLubyte* v);
+	extern void APIENTRY glVertexAttrib4usvARB(GLuint index, const GLushort* v);
+	extern void APIENTRY glVertexAttrib4uivARB(GLuint index, const GLuint* v);
+	extern void APIENTRY glVertexAttrib4fvARB(GLuint index, const GLfloat* v);
+	extern void APIENTRY glVertexAttrib4dvARB(GLuint index, const GLdouble* v);
+	extern void APIENTRY glVertexAttrib4NbvARB(GLuint index, const GLbyte* v);
+	extern void APIENTRY glVertexAttrib4NsvARB(GLuint index, const GLshort* v);
+	extern void APIENTRY glVertexAttrib4NivARB(GLuint index, const GLint* v);
+	extern void APIENTRY glVertexAttrib4NubvARB(GLuint index, const GLubyte* v);
+	extern void APIENTRY glVertexAttrib4NusvARB(GLuint index, const GLushort* v);
+	extern void APIENTRY glVertexAttrib4NuivARB(GLuint index, const GLuint* v);
+	extern void APIENTRY glVertexAttribPointerARB(GLuint index, GLint size, GLenum type, GLboolean normalized, GLsizei stride, const void* pointer);
+	extern void APIENTRY glEnableVertexAttribArrayARB(GLuint index);
+	extern void APIENTRY glDisableVertexAttribArrayARB(GLuint index);
+	extern void APIENTRY glProgramStringARB(GLenum target, GLenum format, GLsizei len, const void* string);
+	extern void APIENTRY glBindProgramARB(GLenum target, GLuint program);
+	extern void APIENTRY glDeleteProgramsARB(GLsizei n, const GLuint* programs);
+	extern void APIENTRY glGenProgramsARB(GLsizei n, GLuint* programs);
+	extern void APIENTRY glProgramEnvParameter4dARB(GLenum target, GLuint index, GLdouble x, GLdouble y, GLdouble z, GLdouble w);
+	extern void APIENTRY glProgramEnvParameter4dvARB(GLenum target, GLuint index, const GLdouble* params);
+	extern void APIENTRY glProgramEnvParameter4fARB(GLenum target, GLuint index, GLfloat x, GLfloat y, GLfloat z, GLfloat w);
+	extern void APIENTRY glProgramEnvParameter4fvARB(GLenum target, GLuint index, const GLfloat* params);
+	extern void APIENTRY glProgramLocalParameter4dARB(GLenum target, GLuint index, GLdouble x, GLdouble y, GLdouble z, GLdouble w);
+	extern void APIENTRY glProgramLocalParameter4dvARB(GLenum target, GLuint index, const GLdouble* params);
+	extern void APIENTRY glProgramLocalParameter4fARB(GLenum target, GLuint index, GLfloat x, GLfloat y, GLfloat z, GLfloat w);
+	extern void APIENTRY glProgramLocalParameter4fvARB(GLenum target, GLuint index, const GLfloat* params);
+	extern void APIENTRY glGetProgramEnvParameterdvARB(GLenum target, GLuint index, GLdouble* params);
+	extern void APIENTRY glGetProgramEnvParameterfvARB(GLenum target, GLuint index, GLfloat* params);
+	extern void APIENTRY glGetProgramLocalParameterdvARB(GLenum target, GLuint index, GLdouble* params);
+	extern void APIENTRY glGetProgramLocalParameterfvARB(GLenum target, GLuint index, GLfloat* params);
+	extern void APIENTRY glGetProgramivARB(GLenum target, GLenum pname, GLint* params);
+	extern void APIENTRY glGetProgramStringARB(GLenum target, GLenum pname, void* string);
+	extern void APIENTRY glGetVertexAttribdvARB(GLuint index, GLenum pname, GLdouble* params);
+	extern void APIENTRY glGetVertexAttribfvARB(GLuint index, GLenum pname, GLfloat* params);
+	extern void APIENTRY glGetVertexAttribivARB(GLuint index, GLenum pname, GLint* params);
+	extern void APIENTRY glGetVertexAttribPointervARB(GLuint index, GLenum pname, void** pointer);
+	extern GLboolean APIENTRY glIsProgramARB(GLuint program);
+#endif
+	typedef void (APIENTRY* PFNGLVERTEXATTRIB1SARBPROC)(GLuint index, GLshort x);
+	typedef void (APIENTRY* PFNGLVERTEXATTRIB1FARBPROC)(GLuint index, GLfloat x);
+	typedef void (APIENTRY* PFNGLVERTEXATTRIB1DARBPROC)(GLuint index, GLdouble x);
+	typedef void (APIENTRY* PFNGLVERTEXATTRIB2SARBPROC)(GLuint index, GLshort x, GLshort y);
+	typedef void (APIENTRY* PFNGLVERTEXATTRIB2FARBPROC)(GLuint index, GLfloat x, GLfloat y);
+	typedef void (APIENTRY* PFNGLVERTEXATTRIB2DARBPROC)(GLuint index, GLdouble x, GLdouble y);
+	typedef void (APIENTRY* PFNGLVERTEXATTRIB3SARBPROC)(GLuint index, GLshort x, GLshort y, GLshort z);
+	typedef void (APIENTRY* PFNGLVERTEXATTRIB3FARBPROC)(GLuint index, GLfloat x, GLfloat y, GLfloat z);
+	typedef void (APIENTRY* PFNGLVERTEXATTRIB3DARBPROC)(GLuint index, GLdouble x, GLdouble y, GLdouble z);
+	typedef void (APIENTRY* PFNGLVERTEXATTRIB4SARBPROC)(GLuint index, GLshort x, GLshort y, GLshort z, GLshort w);
+	typedef void (APIENTRY* PFNGLVERTEXATTRIB4FARBPROC)(GLuint index, GLfloat x, GLfloat y, GLfloat z, GLfloat w);
+	typedef void (APIENTRY* PFNGLVERTEXATTRIB4DARBPROC)(GLuint index, GLdouble x, GLdouble y, GLdouble z, GLdouble w);
+	typedef void (APIENTRY* PFNGLVERTEXATTRIB4NUBARBPROC)(GLuint index, GLubyte x, GLubyte y, GLubyte z, GLubyte w);
+	typedef void (APIENTRY* PFNGLVERTEXATTRIB1SVARBPROC)(GLuint index, const GLshort* v);
+	typedef void (APIENTRY* PFNGLVERTEXATTRIB1FVARBPROC)(GLuint index, const GLfloat* v);
+	typedef void (APIENTRY* PFNGLVERTEXATTRIB1DVARBPROC)(GLuint index, const GLdouble* v);
+	typedef void (APIENTRY* PFNGLVERTEXATTRIB2SVARBPROC)(GLuint index, const GLshort* v);
+	typedef void (APIENTRY* PFNGLVERTEXATTRIB2FVARBPROC)(GLuint index, const GLfloat* v);
+	typedef void (APIENTRY* PFNGLVERTEXATTRIB2DVARBPROC)(GLuint index, const GLdouble* v);
+	typedef void (APIENTRY* PFNGLVERTEXATTRIB3SVARBPROC)(GLuint index, const GLshort* v);
+	typedef void (APIENTRY* PFNGLVERTEXATTRIB3FVARBPROC)(GLuint index, const GLfloat* v);
+	typedef void (APIENTRY* PFNGLVERTEXATTRIB3DVARBPROC)(GLuint index, const GLdouble* v);
+	typedef void (APIENTRY* PFNGLVERTEXATTRIB4BVARBPROC)(GLuint index, const GLbyte* v);
+	typedef void (APIENTRY* PFNGLVERTEXATTRIB4SVARBPROC)(GLuint index, const GLshort* v);
+	typedef void (APIENTRY* PFNGLVERTEXATTRIB4IVARBPROC)(GLuint index, const GLint* v);
+	typedef void (APIENTRY* PFNGLVERTEXATTRIB4UBVARBPROC)(GLuint index, const GLubyte* v);
+	typedef void (APIENTRY* PFNGLVERTEXATTRIB4USVARBPROC)(GLuint index, const GLushort* v);
+	typedef void (APIENTRY* PFNGLVERTEXATTRIB4UIVARBPROC)(GLuint index, const GLuint* v);
+	typedef void (APIENTRY* PFNGLVERTEXATTRIB4FVARBPROC)(GLuint index, const GLfloat* v);
+	typedef void (APIENTRY* PFNGLVERTEXATTRIB4DVARBPROC)(GLuint index, const GLdouble* v);
+	typedef void (APIENTRY* PFNGLVERTEXATTRIB4NBVARBPROC)(GLuint index, const GLbyte* v);
+	typedef void (APIENTRY* PFNGLVERTEXATTRIB4NSVARBPROC)(GLuint index, const GLshort* v);
+	typedef void (APIENTRY* PFNGLVERTEXATTRIB4NIVARBPROC)(GLuint index, const GLint* v);
+	typedef void (APIENTRY* PFNGLVERTEXATTRIB4NUBVARBPROC)(GLuint index, const GLubyte* v);
+	typedef void (APIENTRY* PFNGLVERTEXATTRIB4NUSVARBPROC)(GLuint index, const GLushort* v);
+	typedef void (APIENTRY* PFNGLVERTEXATTRIB4NUIVARBPROC)(GLuint index, const GLuint* v);
+	typedef void (APIENTRY* PFNGLVERTEXATTRIBPOINTERARBPROC)(GLuint index, GLint size, GLenum type, GLboolean normalized, GLsizei stride, const void* pointer);
+	typedef void (APIENTRY* PFNGLENABLEVERTEXATTRIBARRAYARBPROC)(GLuint index);
+	typedef void (APIENTRY* PFNGLDISABLEVERTEXATTRIBARRAYARBPROC)(GLuint index);
+	typedef void (APIENTRY* PFNGLPROGRAMSTRINGARBPROC)(GLenum target, GLenum format, GLsizei len, const void* string);
+	typedef void (APIENTRY* PFNGLBINDPROGRAMARBPROC)(GLenum target, GLuint program);
+	typedef void (APIENTRY* PFNGLDELETEPROGRAMSARBPROC)(GLsizei n, const GLuint* programs);
+	typedef void (APIENTRY* PFNGLGENPROGRAMSARBPROC)(GLsizei n, GLuint* programs);
+	typedef void (APIENTRY* PFNGLPROGRAMENVPARAMETER4DARBPROC)(GLenum target, GLuint index, GLdouble x, GLdouble y, GLdouble z, GLdouble w);
+	typedef void (APIENTRY* PFNGLPROGRAMENVPARAMETER4DVARBPROC)(GLenum target, GLuint index, const GLdouble* params);
+	typedef void (APIENTRY* PFNGLPROGRAMENVPARAMETER4FARBPROC)(GLenum target, GLuint index, GLfloat x, GLfloat y, GLfloat z, GLfloat w);
+	typedef void (APIENTRY* PFNGLPROGRAMENVPARAMETER4FVARBPROC)(GLenum target, GLuint index, const GLfloat* params);
+	typedef void (APIENTRY* PFNGLPROGRAMLOCALPARAMETER4DARBPROC)(GLenum target, GLuint index, GLdouble x, GLdouble y, GLdouble z, GLdouble w);
+	typedef void (APIENTRY* PFNGLPROGRAMLOCALPARAMETER4DVARBPROC)(GLenum target, GLuint index, const GLdouble* params);
+	typedef void (APIENTRY* PFNGLPROGRAMLOCALPARAMETER4FARBPROC)(GLenum target, GLuint index, GLfloat x, GLfloat y, GLfloat z, GLfloat w);
+	typedef void (APIENTRY* PFNGLPROGRAMLOCALPARAMETER4FVARBPROC)(GLenum target, GLuint index, const GLfloat* params);
+	typedef void (APIENTRY* PFNGLGETPROGRAMENVPARAMETERDVARBPROC)(GLenum target, GLuint index, GLdouble* params);
+	typedef void (APIENTRY* PFNGLGETPROGRAMENVPARAMETERFVARBPROC)(GLenum target, GLuint index, GLfloat* params);
+	typedef void (APIENTRY* PFNGLGETPROGRAMLOCALPARAMETERDVARBPROC)(GLenum target, GLuint index, GLdouble* params);
+	typedef void (APIENTRY* PFNGLGETPROGRAMLOCALPARAMETERFVARBPROC)(GLenum target, GLuint index, GLfloat* params);
+	typedef void (APIENTRY* PFNGLGETPROGRAMIVARBPROC)(GLenum target, GLenum pname, GLint* params);
+	typedef void (APIENTRY* PFNGLGETPROGRAMSTRINGARBPROC)(GLenum target, GLenum pname, void* string);
+	typedef void (APIENTRY* PFNGLGETVERTEXATTRIBDVARBPROC)(GLuint index, GLenum pname, GLdouble* params);
+	typedef void (APIENTRY* PFNGLGETVERTEXATTRIBFVARBPROC)(GLuint index, GLenum pname, GLfloat* params);
+	typedef void (APIENTRY* PFNGLGETVERTEXATTRIBIVARBPROC)(GLuint index, GLenum pname, GLint* params);
+	typedef void (APIENTRY* PFNGLGETVERTEXATTRIBPOINTERVARBPROC)(GLuint index, GLenum pname, void** pointer);
+	typedef GLboolean(APIENTRY* PFNGLISPROGRAMARBPROC)(GLuint program);
+#endif
+
+#ifndef GL_ARB_window_pos
+#define GL_ARB_window_pos 1
+#ifdef GL_GLEXT_PROTOTYPES
+	extern void APIENTRY glWindowPos2dARB(GLdouble x, GLdouble y);
+	extern void APIENTRY glWindowPos2fARB(GLfloat x, GLfloat y);
+	extern void APIENTRY glWindowPos2iARB(GLint x, GLint y);
+	extern void APIENTRY glWindowPos2sARB(GLshort x, GLshort y);
+	extern void APIENTRY glWindowPos2dvARB(const GLdouble* p);
+	extern void APIENTRY glWindowPos2fvARB(const GLfloat* p);
+	extern void APIENTRY glWindowPos2ivARB(const GLint* p);
+	extern void APIENTRY glWindowPos2svARB(const GLshort* p);
+	extern void APIENTRY glWindowPos3dARB(GLdouble x, GLdouble y, GLdouble z);
+	extern void APIENTRY glWindowPos3fARB(GLfloat x, GLfloat y, GLfloat z);
+	extern void APIENTRY glWindowPos3iARB(GLint x, GLint y, GLint z);
+	extern void APIENTRY glWindowPos3sARB(GLshort x, GLshort y, GLshort z);
+	extern void APIENTRY glWindowPos3dvARB(const GLdouble* p);
+	extern void APIENTRY glWindowPos3fvARB(const GLfloat* p);
+	extern void APIENTRY glWindowPos3ivARB(const GLint* p);
+	extern void APIENTRY glWindowPos3svARB(const GLshort* p);
+#endif
+	typedef void (APIENTRY* PFNGLWINDOWPOS2DARBPROC)(GLdouble x, GLdouble y);
+	typedef void (APIENTRY* PFNGLWINDOWPOS2FARBPROC)(GLfloat x, GLfloat y);
+	typedef void (APIENTRY* PFNGLWINDOWPOS2IARBPROC)(GLint x, GLint y);
+	typedef void (APIENTRY* PFNGLWINDOWPOS2SARBPROC)(GLshort x, GLshort y);
+	typedef void (APIENTRY* PFNGLWINDOWPOS2DVARBPROC)(const GLdouble* p);
+	typedef void (APIENTRY* PFNGLWINDOWPOS2FVARBPROC)(const GLfloat* p);
+	typedef void (APIENTRY* PFNGLWINDOWPOS2IVARBPROC)(const GLint* p);
+	typedef void (APIENTRY* PFNGLWINDOWPOS2SVARBPROC)(const GLshort* p);
+	typedef void (APIENTRY* PFNGLWINDOWPOS3DARBPROC)(GLdouble x, GLdouble y, GLdouble z);
+	typedef void (APIENTRY* PFNGLWINDOWPOS3FARBPROC)(GLfloat x, GLfloat y, GLfloat z);
+	typedef void (APIENTRY* PFNGLWINDOWPOS3IARBPROC)(GLint x, GLint y, GLint z);
+	typedef void (APIENTRY* PFNGLWINDOWPOS3SARBPROC)(GLshort x, GLshort y, GLshort z);
+	typedef void (APIENTRY* PFNGLWINDOWPOS3DVARBPROC)(const GLdouble* p);
+	typedef void (APIENTRY* PFNGLWINDOWPOS3FVARBPROC)(const GLfloat* p);
+	typedef void (APIENTRY* PFNGLWINDOWPOS3IVARBPROC)(const GLint* p);
+	typedef void (APIENTRY* PFNGLWINDOWPOS3SVARBPROC)(const GLshort* p);
+#endif
+
+#ifndef GL_EXT_abgr
+#define GL_EXT_abgr 1
+#endif
+
+#ifndef GL_EXT_bgra
+#define GL_EXT_bgra 1
+#endif
+
+#ifndef GL_EXT_blend_color
+#define GL_EXT_blend_color 1
+#ifdef GL_GLEXT_PROTOTYPES
+	extern void APIENTRY glBlendColorEXT(GLclampf, GLclampf, GLclampf, GLclampf);
+#endif /* GL_GLEXT_PROTOTYPES */
+	typedef void (APIENTRY* PFNGLBLENDCOLOREXTPROC)(GLclampf red, GLclampf green, GLclampf blue, GLclampf alpha);
+#endif
+
+#ifndef GL_EXT_blend_func_separate
+#define GL_EXT_blend_func_separate 1
+#ifdef GL_GLEXT_PROTOTYPES
+	extern void APIENTRY glBlendFuncSeparateEXT(GLenum, GLenum, GLenum, GLenum);
+#endif /* GL_GLEXT_PROTOTYPES */
+	typedef void (APIENTRY* PFNGLBLENDFUNCSEPARATEEXTPROC)(GLenum sfactorRGB, GLenum dfactorRGB, GLenum sfactorAlpha, GLenum dfactorAlpha);
+#endif
+
+#ifndef GL_EXT_blend_minmax
+#define GL_EXT_blend_minmax 1
+#ifdef GL_GLEXT_PROTOTYPES
+	extern void APIENTRY glBlendEquationEXT(GLenum);
+#endif /* GL_GLEXT_PROTOTYPES */
+	typedef void (APIENTRY* PFNGLBLENDEQUATIONEXTPROC)(GLenum mode);
+#endif
+
+#ifndef GL_EXT_blend_subtract
+#define GL_EXT_blend_subtract 1
+#endif
+
+#ifndef GL_EXT_compiled_vertex_array
+#define GL_EXT_compiled_vertex_array 1
+#ifdef GL_GLEXT_PROTOTYPES
+	extern void APIENTRY glLockArraysEXT(GLint, GLsizei);
+	extern void APIENTRY glUnlockArraysEXT(void);
+#endif /* GL_GLEXT_PROTOTYPES */
+	typedef void (APIENTRY* PFNGLLOCKARRAYSEXTPROC)(GLint first, GLsizei count);
+	typedef void (APIENTRY* PFNGLUNLOCKARRAYSEXTPROC)(void);
+#endif
+
+#ifndef GL_EXT_draw_range_elements
+#define GL_EXT_draw_range_elements 1
+#ifdef GL_GLEXT_PROTOTYPES
+	extern void APIENTRY glDrawRangeElementsEXT(GLenum, GLuint, GLuint, GLsizei, GLenum, const GLvoid*);
+#endif /* GL_GLEXT_PROTOTYPES */
+	typedef void (APIENTRY* PFNGLDRAWRANGEELEMENTSEXTPROC)(GLenum mode, GLuint start, GLuint end, GLsizei count, GLenum type, const GLvoid* indices);
+#endif
+
+#ifndef GL_EXT_fog_coord
+#define GL_EXT_fog_coord 1
+#ifdef GL_GLEXT_PROTOTYPES
+	extern void APIENTRY glFogCoordfEXT(GLfloat);
+	extern void APIENTRY glFogCoordfvEXT(const GLfloat*);
+	extern void APIENTRY glFogCoorddEXT(GLdouble);
+	extern void APIENTRY glFogCoorddvEXT(const GLdouble*);
+	extern void APIENTRY glFogCoordPointerEXT(GLenum, GLsizei, const GLvoid*);
+#endif /* GL_GLEXT_PROTOTYPES */
+	typedef void (APIENTRY* PFNGLFOGCOORDFEXTPROC)(GLfloat coord);
+	typedef void (APIENTRY* PFNGLFOGCOORDFVEXTPROC)(const GLfloat* coord);
+	typedef void (APIENTRY* PFNGLFOGCOORDDEXTPROC)(GLdouble coord);
+	typedef void (APIENTRY* PFNGLFOGCOORDDVEXTPROC)(const GLdouble* coord);
+	typedef void (APIENTRY* PFNGLFOGCOORDPOINTEREXTPROC)(GLenum type, GLsizei stride, const GLvoid* pointer);
+#endif
+
+#ifndef GL_EXT_multi_draw_arrays
+#define GL_EXT_multi_draw_arrays 1
+#ifdef GL_GLEXT_PROTOTYPES
+	extern void APIENTRY glMultiDrawArraysEXT(GLenum, GLint*, GLsizei*, GLsizei);
+	extern void APIENTRY glMultiDrawElementsEXT(GLenum, const GLsizei*, GLenum, const GLvoid**, GLsizei);
+#endif /* GL_GLEXT_PROTOTYPES */
+	typedef void (APIENTRY* PFNGLMULTIDRAWARRAYSEXTPROC)(GLenum mode, GLint* first, GLsizei* count, GLsizei primcount);
+	typedef void (APIENTRY* PFNGLMULTIDRAWELEMENTSEXTPROC)(GLenum mode, const GLsizei* count, GLenum type, const GLvoid* *indices, GLsizei primcount);
+#endif
+
+#ifndef GL_EXT_packed_pixels
+#define GL_EXT_packed_pixels 1
+#endif
+
+#ifndef GL_EXT_paletted_texture
+#define GL_EXT_paletted_texture 1
+#ifdef GL_GLEXT_PROTOTYPES
+	extern void APIENTRY glColorTableEXT(GLenum, GLenum, GLsizei, GLenum, GLenum, const GLvoid*);
+	extern void APIENTRY glColorSubTableEXT(GLenum target, GLsizei start, GLsizei count, GLenum format, GLenum type, const GLvoid* data);
+	extern void APIENTRY glGetColorTableEXT(GLenum, GLenum, GLenum, GLvoid*);
+	extern void APIENTRY glGetColorTableParameterivEXT(GLenum, GLenum, GLint*);
+	extern void APIENTRY glGetColorTableParameterfvEXT(GLenum, GLenum, GLfloat*);
+#endif /* GL_GLEXT_PROTOTYPES */
+	typedef void (APIENTRY* PFNGLCOLORTABLEEXTPROC)(GLenum target, GLenum internalFormat, GLsizei width, GLenum format, GLenum type, const GLvoid* table);
+	typedef void (APIENTRY* PFNGLCOLORSUBTABLEEXTPROC)(GLenum target, GLsizei start, GLsizei count, GLenum format, GLenum type, const GLvoid* data);
+	typedef void (APIENTRY* PFNGLGETCOLORTABLEEXTPROC)(GLenum target, GLenum format, GLenum type, GLvoid* data);
+	typedef void (APIENTRY* PFNGLGETCOLORTABLEPARAMETERIVEXTPROC)(GLenum target, GLenum pname, GLint* params);
+	typedef void (APIENTRY* PFNGLGETCOLORTABLEPARAMETERFVEXTPROC)(GLenum target, GLenum pname, GLfloat* params);
+#endif
+
+#ifndef GL_EXT_point_parameters
+#define GL_EXT_point_parameters 1
+#ifdef GL_GLEXT_PROTOTYPES
+	extern void APIENTRY glPointParameterfEXT(GLenum, GLfloat);
+	extern void APIENTRY glPointParameterfvEXT(GLenum, const GLfloat*);
+	extern void APIENTRY glPointParameterfSGIS(GLenum, GLfloat);
+	extern void APIENTRY glPointParameterfvSGIS(GLenum, const GLfloat*);
+#endif /* GL_GLEXT_PROTOTYPES */
+	typedef void (APIENTRY* PFNGLPOINTPARAMETERFEXTPROC)(GLenum pname, GLfloat param);
+	typedef void (APIENTRY* PFNGLPOINTPARAMETERFVEXTPROC)(GLenum pname, const GLfloat* params);
+	typedef void (APIENTRY* PFNGLPOINTPARAMETERFSGISPROC)(GLenum pname, GLfloat param);
+	typedef void (APIENTRY* PFNGLPOINTPARAMETERFVSGISPROC)(GLenum pname, const GLfloat* params);
+#endif
+
+#ifndef GL_EXT_rescale_normal
+#define GL_EXT_rescale_normal 1
+#endif
+
+#ifndef GL_EXT_secondary_color
+#define GL_EXT_secondary_color 1
+#ifdef GL_GLEXT_PROTOTYPES
+	extern void APIENTRY glSecondaryColor3bEXT(GLbyte, GLbyte, GLbyte);
+	extern void APIENTRY glSecondaryColor3bvEXT(const GLbyte*);
+	extern void APIENTRY glSecondaryColor3dEXT(GLdouble, GLdouble, GLdouble);
+	extern void APIENTRY glSecondaryColor3dvEXT(const GLdouble*);
+	extern void APIENTRY glSecondaryColor3fEXT(GLfloat, GLfloat, GLfloat);
+	extern void APIENTRY glSecondaryColor3fvEXT(const GLfloat*);
+	extern void APIENTRY glSecondaryColor3iEXT(GLint, GLint, GLint);
+	extern void APIENTRY glSecondaryColor3ivEXT(const GLint*);
+	extern void APIENTRY glSecondaryColor3sEXT(GLshort, GLshort, GLshort);
+	extern void APIENTRY glSecondaryColor3svEXT(const GLshort*);
+	extern void APIENTRY glSecondaryColor3ubEXT(GLubyte, GLubyte, GLubyte);
+	extern void APIENTRY glSecondaryColor3ubvEXT(const GLubyte*);
+	extern void APIENTRY glSecondaryColor3uiEXT(GLuint, GLuint, GLuint);
+	extern void APIENTRY glSecondaryColor3uivEXT(const GLuint*);
+	extern void APIENTRY glSecondaryColor3usEXT(GLushort, GLushort, GLushort);
+	extern void APIENTRY glSecondaryColor3usvEXT(const GLushort*);
+	extern void APIENTRY glSecondaryColorPointerEXT(GLint, GLenum, GLsizei, GLvoid*);
+#endif /* GL_GLEXT_PROTOTYPES */
+	typedef void (APIENTRY* PFNGLSECONDARYCOLOR3BEXTPROC)(GLbyte red, GLbyte green, GLbyte blue);
+	typedef void (APIENTRY* PFNGLSECONDARYCOLOR3BVEXTPROC)(const GLbyte* v);
+	typedef void (APIENTRY* PFNGLSECONDARYCOLOR3DEXTPROC)(GLdouble red, GLdouble green, GLdouble blue);
+	typedef void (APIENTRY* PFNGLSECONDARYCOLOR3DVEXTPROC)(const GLdouble* v);
+	typedef void (APIENTRY* PFNGLSECONDARYCOLOR3FEXTPROC)(GLfloat red, GLfloat green, GLfloat blue);
+	typedef void (APIENTRY* PFNGLSECONDARYCOLOR3FVEXTPROC)(const GLfloat* v);
+	typedef void (APIENTRY* PFNGLSECONDARYCOLOR3IEXTPROC)(GLint red, GLint green, GLint blue);
+	typedef void (APIENTRY* PFNGLSECONDARYCOLOR3IVEXTPROC)(const GLint* v);
+	typedef void (APIENTRY* PFNGLSECONDARYCOLOR3SEXTPROC)(GLshort red, GLshort green, GLshort blue);
+	typedef void (APIENTRY* PFNGLSECONDARYCOLOR3SVEXTPROC)(const GLshort* v);
+	typedef void (APIENTRY* PFNGLSECONDARYCOLOR3UBEXTPROC)(GLubyte red, GLubyte green, GLubyte blue);
+	typedef void (APIENTRY* PFNGLSECONDARYCOLOR3UBVEXTPROC)(const GLubyte* v);
+	typedef void (APIENTRY* PFNGLSECONDARYCOLOR3UIEXTPROC)(GLuint red, GLuint green, GLuint blue);
+	typedef void (APIENTRY* PFNGLSECONDARYCOLOR3UIVEXTPROC)(const GLuint* v);
+	typedef void (APIENTRY* PFNGLSECONDARYCOLOR3USEXTPROC)(GLushort red, GLushort green, GLushort blue);
+	typedef void (APIENTRY* PFNGLSECONDARYCOLOR3USVEXTPROC)(const GLushort* v);
+	typedef void (APIENTRY* PFNGLSECONDARYCOLORPOINTEREXTPROC)(GLint size, GLenum type, GLsizei stride, GLvoid* pointer);
+#endif
+
+#ifndef GL_EXT_separate_specular_color
+#define GL_EXT_separate_specular_color 1
+#endif
+
+#ifndef GL_EXT_shadow_funcs
+#define GL_EXT_shadow_funcs 1
+#endif
+
+#ifndef GL_EXT_shared_texture_palette
+#define GL_EXT_shared_texture_palette 1
+#endif
+
+#ifndef GL_EXT_stencil_two_side
+#define GL_EXT_stencil_two_side 1
+#ifdef GL_GLEXT_PROTOTYPES
+	extern void glActiveStencilFaceEXT(GLenum face);
+#endif
+	typedef void (APIENTRY* PFNGLACTIVESTENCILFACEEXTPROC)(GLenum face);
+#endif
+
+#ifndef GL_EXT_stencil_wrap
+#define GL_EXT_stencil_wrap 1
+#endif
+
+#ifndef GL_EXT_texture_compression_s3tc
+#define GL_EXT_texture_compression_s3tc 1
+#endif
+
+#ifndef GL_EXT_texture_env_add
+#define GL_EXT_texture_env_add 1
+#endif
+
+#ifndef GL_EXT_texture_env_combine
+#define GL_EXT_texture_env_combine 1
+#endif
+
+#ifndef GL_EXT_texture_env_dot3
+#define GL_EXT_texture_env_dot3 1
+#endif
+
+#ifndef GL_EXT_texture_filter_anisotropic
+#define GL_EXT_texture_filter_anisotropic 1
+#endif
+
+#ifndef GL_EXT_texture_lod_bias
+#define GL_EXT_texture_lod_bias 1
+#endif
+
+#ifndef GL_EXT_texture_object
+#define GL_EXT_texture_object 1
+#ifdef GL_GLEXT_PROTOTYPES
+	extern GLboolean APIENTRY glAreTexturesResidentEXT(GLsizei, const GLuint*, GLboolean*);
+	extern void APIENTRY glBindTextureEXT(GLenum, GLuint);
+	extern void APIENTRY glDeleteTexturesEXT(GLsizei, const GLuint*);
+	extern void APIENTRY glGenTexturesEXT(GLsizei, GLuint*);
+	extern GLboolean APIENTRY glIsTextureEXT(GLuint);
+	extern void APIENTRY glPrioritizeTexturesEXT(GLsizei, const GLuint*, const GLclampf*);
+#endif /* GL_GLEXT_PROTOTYPES */
+	typedef GLboolean(APIENTRY* PFNGLARETEXTURESRESIDENTEXTPROC)(GLsizei n, const GLuint* textures, GLboolean* residences);
+	typedef void (APIENTRY* PFNGLBINDTEXTUREEXTPROC)(GLenum target, GLuint texture);
+	typedef void (APIENTRY* PFNGLDELETETEXTURESEXTPROC)(GLsizei n, const GLuint* textures);
+	typedef void (APIENTRY* PFNGLGENTEXTURESEXTPROC)(GLsizei n, GLuint* textures);
+	typedef GLboolean(APIENTRY* PFNGLISTEXTUREEXTPROC)(GLuint texture);
+	typedef void (APIENTRY* PFNGLPRIORITIZETEXTURESEXTPROC)(GLsizei n, const GLuint* textures, const GLclampf* priorities);
+#endif
+
+#ifndef GL_EXT_texture3D
+#define GL_EXT_texture3D 1
+#ifdef GL_GLEXT_PROTOTYPES
+	extern void APIENTRY glTexImage3DEXT(GLenum, GLint, GLenum, GLsizei, GLsizei, GLsizei, GLint, GLenum, GLenum, const GLvoid*);
+	extern void APIENTRY glTexSubImage3DEXT(GLenum, GLint, GLint, GLint, GLint, GLsizei, GLsizei, GLsizei, GLenum, GLenum, const GLvoid*);
+#endif /* GL_GLEXT_PROTOTYPES */
+	typedef void (APIENTRY* PFNGLTEXIMAGE3DEXTPROC)(GLenum target, GLint level, GLenum internalformat, GLsizei width, GLsizei height, GLsizei depth, GLint border, GLenum format, GLenum type, const GLvoid* pixels);
+	typedef void (APIENTRY* PFNGLTEXSUBIMAGE3DEXTPROC)(GLenum target, GLint level, GLint xoffset, GLint yoffset, GLint zoffset, GLsizei width, GLsizei height, GLsizei depth, GLenum format, GLenum type, const GLvoid* pixels);
+#endif
+
+#ifndef GL_EXT_vertex_array
+#define GL_EXT_vertex_array 1
+#ifdef GL_GLEXT_PROTOTYPES
+	extern void APIENTRY glArrayElementEXT(GLint);
+	extern void APIENTRY glColorPointerEXT(GLint, GLenum, GLsizei, GLsizei, const GLvoid*);
+	extern void APIENTRY glDrawArraysEXT(GLenum, GLint, GLsizei);
+	extern void APIENTRY glEdgeFlagPointerEXT(GLsizei, GLsizei, const GLboolean*);
+	extern void APIENTRY glGetPointervEXT(GLenum, GLvoid**);
+	extern void APIENTRY glIndexPointerEXT(GLenum, GLsizei, GLsizei, const GLvoid*);
+	extern void APIENTRY glNormalPointerEXT(GLenum, GLsizei, GLsizei, const GLvoid*);
+	extern void APIENTRY glTexCoordPointerEXT(GLint, GLenum, GLsizei, GLsizei, const GLvoid*);
+	extern void APIENTRY glVertexPointerEXT(GLint, GLenum, GLsizei, GLsizei, const GLvoid*);
+#endif /* GL_GLEXT_PROTOTYPES */
+	typedef void (APIENTRY* PFNGLARRAYELEMENTEXTPROC)(GLint i);
+	typedef void (APIENTRY* PFNGLCOLORPOINTEREXTPROC)(GLint size, GLenum type, GLsizei stride, GLsizei count, const GLvoid* pointer);
+	typedef void (APIENTRY* PFNGLDRAWARRAYSEXTPROC)(GLenum mode, GLint first, GLsizei count);
+	typedef void (APIENTRY* PFNGLEDGEFLAGPOINTEREXTPROC)(GLsizei stride, GLsizei count, const GLboolean* pointer);
+	typedef void (APIENTRY* PFNGLGETPOINTERVEXTPROC)(GLenum pname, GLvoid* *params);
+	typedef void (APIENTRY* PFNGLINDEXPOINTEREXTPROC)(GLenum type, GLsizei stride, GLsizei count, const GLvoid* pointer);
+	typedef void (APIENTRY* PFNGLNORMALPOINTEREXTPROC)(GLenum type, GLsizei stride, GLsizei count, const GLvoid* pointer);
+	typedef void (APIENTRY* PFNGLTEXCOORDPOINTEREXTPROC)(GLint size, GLenum type, GLsizei stride, GLsizei count, const GLvoid* pointer);
+	typedef void (APIENTRY* PFNGLVERTEXPOINTEREXTPROC)(GLint size, GLenum type, GLsizei stride, GLsizei count, const GLvoid* pointer);
+#endif
+
+#ifndef GL_EXT_vertex_weighting
+#define GL_EXT_vertex_weighting 1
+#ifdef GL_GLEXT_PROTOTYPES
+	extern void APIENTRY glVertexWeightfEXT(GLfloat);
+	extern void APIENTRY glVertexWeightfvEXT(const GLfloat*);
+	extern void APIENTRY glVertexWeightPointerEXT(GLsizei, GLenum, GLsizei, const GLvoid*);
+#endif /* GL_GLEXT_PROTOTYPES */
+	typedef void (APIENTRY* PFNGLVERTEXWEIGHTFEXTPROC)(GLfloat weight);
+	typedef void (APIENTRY* PFNGLVERTEXWEIGHTFVEXTPROC)(const GLfloat* weight);
+	typedef void (APIENTRY* PFNGLVERTEXWEIGHTPOINTEREXTPROC)(GLsizei size, GLenum type, GLsizei stride, const GLvoid* pointer);
+#endif
+
+#ifndef GL_HP_occlusion_test
+#define GL_HP_occlusion_test 1
+#endif
+
+#ifndef GL_IBM_texture_mirrored_repeat
+#define GL_IBM_texture_mirrored_repeat 1
+#endif
+
+#ifndef GL_NV_blend_square
+#define GL_NV_blend_square 1
+#endif
+
+#ifndef GL_NV_copy_depth_to_color
+#define GL_NV_copy_depth_to_color 1
+#endif
+
+#ifndef GL_NV_depth_clamp
+#define GL_NV_depth_clamp 1
+#endif
+
+#ifndef GL_NV_element_array
+#define GL_NV_element_array 1
+#ifdef GL_GLEXT_PROTOTYPES
+	extern void APIENTRY glElementPointerNV(GLenum type, const GLvoid* pointer);
+	extern void APIENTRY glDrawElementArrayNV(GLenum mode, GLint first, GLsizei count);
+	extern void APIENTRY glDrawRangeElementArrayNV(GLenum mode, GLuint start, GLuint end, GLint first, GLsizei count);
+	extern void APIENTRY glMultiDrawElementArrayNV(GLenum mode, const GLint* first, const GLsizei* count, GLsizei primcount);
+	extern void APIENTRY glMultiDrawRangeElementArrayNV(GLenum mode, GLuint start, GLuint end, const GLint* first, const GLsizei* count, GLsizei primcount);
+#endif
+	typedef void (APIENTRY* PFNGLELEMENTPOINTERNVPROC)(GLenum type, const GLvoid* pointer);
+	typedef void (APIENTRY* PFNGLDRAWELEMENTARRAYNVPROC)(GLenum mode, GLint first, GLsizei count);
+	typedef void (APIENTRY* PFNGLDRAWRANGEELEMENTARRAYNVPROC)(GLenum mode, GLuint start, GLuint end, GLint first, GLsizei count);
+	typedef void (APIENTRY* PFNGLMULTIDRAWELEMENTARRAYNVPROC)(GLenum mode, const GLint* first, const GLsizei* count, GLsizei primcount);
+	typedef void (APIENTRY* PFNGLMULTIDRAWRANGEELEMENTARRAYNVPROC)(GLenum mode, GLuint start, GLuint end, const GLint* first, const GLsizei* count, GLsizei primcount);
+#endif
+
+#ifndef GL_NV_fence
+#define GL_NV_fence 1
+#ifdef GL_GLEXT_PROTOTYPES
+	extern void APIENTRY glDeleteFencesNV(GLsizei n, const GLuint* fences);
+	extern void APIENTRY glGenFencesNV(GLsizei n, GLuint* fences);
+	extern GLboolean APIENTRY glIsFenceNV(GLuint fence);
+	extern GLboolean APIENTRY glTestFenceNV(GLuint fence);
+	extern void APIENTRY glGetFenceivNV(GLuint fence, GLenum pname, GLint* params);
+	extern void APIENTRY glFinishFenceNV(GLuint fence);
+	extern void APIENTRY glSetFenceNV(GLuint fence, GLenum condition);
+#endif
+	typedef void (APIENTRY* PFNGLDELETEFENCESNVPROC)(GLsizei n, const GLuint* fences);
+	typedef void (APIENTRY* PFNGLGENFENCESNVPROC)(GLsizei n, GLuint* fences);
+	typedef GLboolean(APIENTRY* PFNGLISFENCENVPROC)(GLuint fence);
+	typedef GLboolean(APIENTRY* PFNGLTESTFENCENVPROC)(GLuint fence);
+	typedef void (APIENTRY* PFNGLGETFENCEIVNVPROC)(GLuint fence, GLenum pname, GLint* params);
+	typedef void (APIENTRY* PFNGLFINISHFENCENVPROC)(GLuint fence);
+	typedef void (APIENTRY* PFNGLSETFENCENVPROC)(GLuint fence, GLenum condition);
+#endif
+
+#ifndef GL_NV_float_buffer
+#define GL_NV_float_buffer 1
+#endif
+
+#ifndef GL_NV_fog_distance
+#define GL_NV_fog_distance 1
+#endif
+
+#ifndef GL_NV_fragment_program
+#define GL_NV_fragment_program 1
+#ifdef GL_GLEXT_PROTOTYPES
+	extern void APIENTRY glProgramNamedParameter4fNV(GLuint id, GLsizei len, const GLubyte* name, GLfloat x, GLfloat y, GLfloat z, GLfloat w);
+	extern void APIENTRY glProgramNamedParameter4dNV(GLuint id, GLsizei len, const GLubyte* name, GLdouble x, GLdouble y, GLdouble z, GLdouble w);
+	extern void APIENTRY glProgramNamedParameter4fvNV(GLuint id, GLsizei len, const GLubyte* name, const GLfloat v[]);
+	extern void APIENTRY glProgramNamedParameter4dvNV(GLuint id, GLsizei len, const GLubyte* name, const GLdouble v[]);
+	extern void APIENTRY glGetProgramNamedParameterfvNV(GLuint id, GLsizei len, const GLubyte* name, GLfloat* params);
+	extern void APIENTRY glGetProgramNamedParameterdvNV(GLuint id, GLsizei len, const GLubyte* name, GLdouble* params);
+#endif
+	typedef void (APIENTRY* PFNGLPROGRAMNAMEDPARAMETER4FNVPROC)(GLuint id, GLsizei len, const GLubyte* name, GLfloat x, GLfloat y, GLfloat z, GLfloat w);
+	typedef void (APIENTRY* PFNGLPROGRAMNAMEDPARAMETER4DNVPROC)(GLuint id, GLsizei len, const GLubyte* name, GLdouble x, GLdouble y, GLdouble z, GLdouble w);
+	typedef void (APIENTRY* PFNGLPROGRAMNAMEDPARAMETER4FVNVPROC)(GLuint id, GLsizei len, const GLubyte* name, const GLfloat v[]);
+	typedef void (APIENTRY* PFNGLPROGRAMNAMEDPARAMETER4DVNVPROC)(GLuint id, GLsizei len, const GLubyte* name, const GLdouble v[]);
+	typedef void (APIENTRY* PFNGLGETPROGRAMNAMEDPARAMETERFVNVPROC)(GLuint id, GLsizei len, const GLubyte* name, GLfloat* params);
+	typedef void (APIENTRY* PFNGLGETPROGRAMNAMEDPARAMETERDVNVPROC)(GLuint id, GLsizei len, const GLubyte* name, GLdouble* params);
+#endif
+
+#ifndef GL_NV_half_float
+#define GL_NV_half_float 1
+#ifndef GLhalf
+	typedef unsigned short GLhalf;
+#endif
+#ifdef GL_GLEXT_PROTOTYPES
+	extern void APIENTRY glVertex2hNV(GLhalf x, GLhalf y);
+	extern void APIENTRY glVertex2hvNV(const GLhalf* v);
+	extern void APIENTRY glVertex3hNV(GLhalf x, GLhalf y, GLhalf z);
+	extern void APIENTRY glVertex3hvNV(const GLhalf* v);
+	extern void APIENTRY glVertex4hNV(GLhalf x, GLhalf y, GLhalf z, GLhalf w);
+	extern void APIENTRY glVertex4hvNV(const GLhalf* v);
+	extern void APIENTRY glNormal3hNV(GLhalf nx, GLhalf ny, GLhalf nz);
+	extern void APIENTRY glNormal3hvNV(const GLhalf* v);
+	extern void APIENTRY glColor3hNV(GLhalf red, GLhalf green, GLhalf blue);
+	extern void APIENTRY glColor3hvNV(const GLhalf* v);
+	extern void APIENTRY glColor4hNV(GLhalf red, GLhalf green, GLhalf blue, GLhalf alpha);
+	extern void APIENTRY glColor4hvNV(const GLhalf* v);
+	extern void APIENTRY glTexCoord1hNV(GLhalf s);
+	extern void APIENTRY glTexCoord1hvNV(const GLhalf* v);
+	extern void APIENTRY glTexCoord2hNV(GLhalf s, GLhalf t);
+	extern void APIENTRY glTexCoord2hvNV(const GLhalf* v);
+	extern void APIENTRY glTexCoord3hNV(GLhalf s, GLhalf t, GLhalf r);
+	extern void APIENTRY glTexCoord3hvNV(const GLhalf* v);
+	extern void APIENTRY glTexCoord4hNV(GLhalf s, GLhalf t, GLhalf r, GLhalf q);
+	extern void APIENTRY glTexCoord4hvNV(const GLhalf* v);
+	extern void APIENTRY glMultiTexCoord1hNV(GLenum target, GLhalf s);
+	extern void APIENTRY glMultiTexCoord1hvNV(GLenum target, const GLhalf* v);
+	extern void APIENTRY glMultiTexCoord2hNV(GLenum target, GLhalf s, GLhalf t);
+	extern void APIENTRY glMultiTexCoord2hvNV(GLenum target, const GLhalf* v);
+	extern void APIENTRY glMultiTexCoord3hNV(GLenum target, GLhalf s, GLhalf t, GLhalf r);
+	extern void APIENTRY glMultiTexCoord3hvNV(GLenum target, const GLhalf* v);
+	extern void APIENTRY glMultiTexCoord4hNV(GLenum target, GLhalf s, GLhalf t, GLhalf r, GLhalf q);
+	extern void APIENTRY glMultiTexCoord4hvNV(GLenum target, const GLhalf* v);
+	extern void APIENTRY glFogCoordhNV(GLhalf fog);
+	extern void APIENTRY glFogCoordhvNV(const GLhalf* fog);
+	extern void APIENTRY glSecondaryColor3hNV(GLhalf red, GLhalf green, GLhalf blue);
+	extern void APIENTRY glSecondaryColor3hvNV(const GLhalf* v);
+	extern void APIENTRY glVertexWeighthNV(GLhalf weight);
+	extern void APIENTRY glVertexWeighthvNV(const GLhalf* weight);
+	extern void APIENTRY glVertexAttrib1hNV(GLuint index, GLhalf x);
+	extern void APIENTRY glVertexAttrib1hvNV(GLuint index, const GLhalf* v);
+	extern void APIENTRY glVertexAttrib2hNV(GLuint index, GLhalf x, GLhalf y);
+	extern void APIENTRY glVertexAttrib2hvNV(GLuint index, const GLhalf* v);
+	extern void APIENTRY glVertexAttrib3hNV(GLuint index, GLhalf x, GLhalf y, GLhalf z);
+	extern void APIENTRY glVertexAttrib3hvNV(GLuint index, const GLhalf* v);
+	extern void APIENTRY glVertexAttrib4hNV(GLuint index, GLhalf x, GLhalf y, GLhalf z, GLhalf w);
+	extern void APIENTRY glVertexAttrib4hvNV(GLuint index, const GLhalf* v);
+	extern void APIENTRY glVertexAttribs1hvNV(GLuint index, GLsizei n, const GLhalf* v);
+	extern void APIENTRY glVertexAttribs2hvNV(GLuint index, GLsizei n, const GLhalf* v);
+	extern void APIENTRY glVertexAttribs3hvNV(GLuint index, GLsizei n, const GLhalf* v);
+	extern void APIENTRY glVertexAttribs4hvNV(GLuint index, GLsizei n, const GLhalf* v);
+#endif
+	typedef void (APIENTRY* PFNGLVERTEX2HNVPROC)(GLhalf x, GLhalf y);
+	typedef void (APIENTRY* PFNGLVERTEX2HVNVPROC)(const GLhalf* v);
+	typedef void (APIENTRY* PFNGLVERTEX3HNVPROC)(GLhalf x, GLhalf y, GLhalf z);
+	typedef void (APIENTRY* PFNGLVERTEX3HVNVPROC)(const GLhalf* v);
+	typedef void (APIENTRY* PFNGLVERTEX4HNVPROC)(GLhalf x, GLhalf y, GLhalf z, GLhalf w);
+	typedef void (APIENTRY* PFNGLVERTEX4HVNVPROC)(const GLhalf* v);
+	typedef void (APIENTRY* PFNGLNORMAL3HNVPROC)(GLhalf nx, GLhalf ny, GLhalf nz);
+	typedef void (APIENTRY* PFNGLNORMAL3HVNVPROC)(const GLhalf* v);
+	typedef void (APIENTRY* PFNGLCOLOR3HNVPROC)(GLhalf red, GLhalf green, GLhalf blue);
+	typedef void (APIENTRY* PFNGLCOLOR3HVNVPROC)(const GLhalf* v);
+	typedef void (APIENTRY* PFNGLCOLOR4HNVPROC)(GLhalf red, GLhalf green, GLhalf blue, GLhalf alpha);
+	typedef void (APIENTRY* PFNGLCOLOR4HVNVPROC)(const GLhalf* v);
+	typedef void (APIENTRY* PFNGLTEXCOORD1HNVPROC)(GLhalf s);
+	typedef void (APIENTRY* PFNGLTEXCOORD1HVNVPROC)(const GLhalf* v);
+	typedef void (APIENTRY* PFNGLTEXCOORD2HNVPROC)(GLhalf s, GLhalf t);
+	typedef void (APIENTRY* PFNGLTEXCOORD2HVNVPROC)(const GLhalf* v);
+	typedef void (APIENTRY* PFNGLTEXCOORD3HNVPROC)(GLhalf s, GLhalf t, GLhalf r);
+	typedef void (APIENTRY* PFNGLTEXCOORD3HVNVPROC)(const GLhalf* v);
+	typedef void (APIENTRY* PFNGLTEXCOORD4HNVPROC)(GLhalf s, GLhalf t, GLhalf r, GLhalf q);
+	typedef void (APIENTRY* PFNGLTEXCOORD4HVNVPROC)(const GLhalf* v);
+	typedef void (APIENTRY* PFNGLMULTITEXCOORD1HNVPROC)(GLenum target, GLhalf s);
+	typedef void (APIENTRY* PFNGLMULTITEXCOORD1HVNVPROC)(GLenum target, const GLhalf* v);
+	typedef void (APIENTRY* PFNGLMULTITEXCOORD2HNVPROC)(GLenum target, GLhalf s, GLhalf t);
+	typedef void (APIENTRY* PFNGLMULTITEXCOORD2HVNVPROC)(GLenum target, const GLhalf* v);
+	typedef void (APIENTRY* PFNGLMULTITEXCOORD3HNVPROC)(GLenum target, GLhalf s, GLhalf t, GLhalf r);
+	typedef void (APIENTRY* PFNGLMULTITEXCOORD3HVNVPROC)(GLenum target, const GLhalf* v);
+	typedef void (APIENTRY* PFNGLMULTITEXCOORD4HNVPROC)(GLenum target, GLhalf s, GLhalf t, GLhalf r, GLhalf q);
+	typedef void (APIENTRY* PFNGLMULTITEXCOORD4HVNVPROC)(GLenum target, const GLhalf* v);
+	typedef void (APIENTRY* PFNGLFOGCOORDHNVPROC)(GLhalf fog);
+	typedef void (APIENTRY* PFNGLFOGCOORDHVNVPROC)(const GLhalf* fog);
+	typedef void (APIENTRY* PFNGLSECONDARYCOLOR3HNVPROC)(GLhalf red, GLhalf green, GLhalf blue);
+	typedef void (APIENTRY* PFNGLSECONDARYCOLOR3HVNVPROC)(const GLhalf* v);
+	typedef void (APIENTRY* PFNGLVERTEXWEIGHTHNVPROC)(GLhalf weight);
+	typedef void (APIENTRY* PFNGLVERTEXWEIGHTHVNVPROC)(const GLhalf* weight);
+	typedef void (APIENTRY* PFNGLVERTEXATTRIB1HNVPROC)(GLuint index, GLhalf x);
+	typedef void (APIENTRY* PFNGLVERTEXATTRIB1HVNVPROC)(GLuint index, const GLhalf* v);
+	typedef void (APIENTRY* PFNGLVERTEXATTRIB2HNVPROC)(GLuint index, GLhalf x, GLhalf y);
+	typedef void (APIENTRY* PFNGLVERTEXATTRIB2HVNVPROC)(GLuint index, const GLhalf* v);
+	typedef void (APIENTRY* PFNGLVERTEXATTRIB3HNVPROC)(GLuint index, GLhalf x, GLhalf y, GLhalf z);
+	typedef void (APIENTRY* PFNGLVERTEXATTRIB3HVNVPROC)(GLuint index, const GLhalf* v);
+	typedef void (APIENTRY* PFNGLVERTEXATTRIB4HNVPROC)(GLuint index, GLhalf x, GLhalf y, GLhalf z, GLhalf w);
+	typedef void (APIENTRY* PFNGLVERTEXATTRIB4HVNVPROC)(GLuint index, const GLhalf* v);
+	typedef void (APIENTRY* PFNGLVERTEXATTRIBS1HVNVPROC)(GLuint index, GLsizei n, const GLhalf* v);
+	typedef void (APIENTRY* PFNGLVERTEXATTRIBS2HVNVPROC)(GLuint index, GLsizei n, const GLhalf* v);
+	typedef void (APIENTRY* PFNGLVERTEXATTRIBS3HVNVPROC)(GLuint index, GLsizei n, const GLhalf* v);
+	typedef void (APIENTRY* PFNGLVERTEXATTRIBS4HVNVPROC)(GLuint index, GLsizei n, const GLhalf* v);
+#endif
+
+#ifndef GL_NV_light_max_exponent
+#define GL_NV_light_max_exponent 1
+#endif
+
+#ifndef GL_NV_multisample_filter_hint
+#define GL_NV_multisample_filter_hint 1
+#endif
+
+#ifndef GL_NV_occlusion_query
+#define GL_NV_occlusion_query 1
+#ifdef GL_GLEXT_PROTOTYPES
+	extern void APIENTRY glGenOcclusionQueriesNV(GLsizei n, GLuint* ids);
+	extern void APIENTRY glDeleteOcclusionQueriesNV(GLsizei n, const GLuint* ids);
+	extern void APIENTRY glIsOcclusionQueryNV(GLuint id);
+	extern void APIENTRY glBeginOcclusionQueryNV(GLuint id);
+	extern void APIENTRY glEndOcclusionQueryNV(GLvoid);
+	extern void APIENTRY glGetOcclusionQueryivNV(GLuint id, GLenum pname, GLint* params);
+	extern void APIENTRY glGetOcclusionQueryuivNV(GLuint id, GLenum pname, GLuint* params);
+#endif
+	typedef void (APIENTRY* PFNGLGENOCCLUSIONQUERIESNVPROC)(GLsizei n, GLuint* ids);
+	typedef void (APIENTRY* PFNGLDELETEOCCLUSIONQUERIESNVPROC)(GLsizei n, const GLuint* ids);
+	typedef void (APIENTRY* PFNGLISOCCLUSIONQUERYNVPROC)(GLuint id);
+	typedef void (APIENTRY* PFNGLBEGINOCCLUSIONQUERYNVPROC)(GLuint id);
+	typedef void (APIENTRY* PFNGLENDOCCLUSIONQUERYNVPROC)(GLvoid);
+	typedef void (APIENTRY* PFNGLGETOCCLUSIONQUERYIVNVPROC)(GLuint id, GLenum pname, GLint* params);
+	typedef void (APIENTRY* PFNGLGETOCCLUSIONQUERYUIVNVPROC)(GLuint id, GLenum pname, GLuint* params);
+#endif
+
+#ifndef GL_NV_packed_depth_stencil
+#define GL_NV_packed_depth_stencil 1
+#endif
+
+#ifndef GL_NV_pixel_data_range
+#define GL_NV_pixel_data_range 1
+#ifdef GL_GLEXT_PROTOTYPES
+	extern void APIENTRY glPixelDataRangeNV(GLenum target, GLsizei length, GLvoid* pointer);
+	extern void APIENTRY glFlushPixelDataRangeNV(GLenum target);
+#endif
+	typedef void (APIENTRY* PFNGLPIXELDATARANGENVPROC)(GLenum target, GLsizei length, GLvoid* pointer);
+	typedef void (APIENTRY* PFNGLFLUSHPIXELDATARANGENVPROC)(GLenum target);
+#endif
+
+#ifndef GL_NV_point_sprite
+#define GL_NV_point_sprite 1
+#ifdef GL_GLEXT_PROTOTYPES
+	extern void APIENTRY glPointParameteriNV(GLenum pname, int param);
+	extern void APIENTRY glPointParameterivNV(GLenum pname, const int* params);
+#endif
+	typedef void (APIENTRY* PFNGLPOINTPARAMETERINVPROC)(GLenum pname, int param);
+	typedef void (APIENTRY* PFNGLPOINTPARAMETERIVNVPROC)(GLenum pname, const int* params);
+#endif
+
+#ifndef GL_NV_primitive_restart
+#define GL_NV_primitive_restart 1
+#ifdef GL_GLEXT_PROTOTYPES
+	extern void APIENTRY glPrimitiveRestartNV(GLvoid);
+	extern void APIENTRY glPrimitiveRestartIndexNV(GLuint index);
+#endif
+	typedef void (APIENTRY* PFNGLPRIMITIVERESTARTNVPROC)(GLvoid);
+	typedef void (APIENTRY* PFNGLPRIMITIVERESTARTINDEXNVPROC)(GLuint index);
+#endif
+
+#ifndef GL_NV_register_combiners
+#define GL_NV_register_combiners 1
+#ifdef GL_GLEXT_PROTOTYPES
+	extern void APIENTRY glCombinerParameterfvNV(GLenum, const GLfloat*);
+	extern void APIENTRY glCombinerParameterfNV(GLenum, GLfloat);
+	extern void APIENTRY glCombinerParameterivNV(GLenum, const GLint*);
+	extern void APIENTRY glCombinerParameteriNV(GLenum, GLint);
+	extern void APIENTRY glCombinerInputNV(GLenum, GLenum, GLenum, GLenum, GLenum, GLenum);
+	extern void APIENTRY glCombinerOutputNV(GLenum, GLenum, GLenum, GLenum, GLenum, GLenum, GLenum, GLboolean, GLboolean, GLboolean);
+	extern void APIENTRY glFinalCombinerInputNV(GLenum, GLenum, GLenum, GLenum);
+	extern void APIENTRY glGetCombinerInputParameterfvNV(GLenum, GLenum, GLenum, GLenum, GLfloat*);
+	extern void APIENTRY glGetCombinerInputParameterivNV(GLenum, GLenum, GLenum, GLenum, GLint*);
+	extern void APIENTRY glGetCombinerOutputParameterfvNV(GLenum, GLenum, GLenum, GLfloat*);
+	extern void APIENTRY glGetCombinerOutputParameterivNV(GLenum, GLenum, GLenum, GLint*);
+	extern void APIENTRY glGetFinalCombinerInputParameterfvNV(GLenum, GLenum, GLfloat*);
+	extern void APIENTRY glGetFinalCombinerInputParameterivNV(GLenum, GLenum, GLint*);
+#endif /* GL_GLEXT_PROTOTYPES */
+	typedef void (APIENTRY* PFNGLCOMBINERPARAMETERFVNVPROC)(GLenum pname, const GLfloat* params);
+	typedef void (APIENTRY* PFNGLCOMBINERPARAMETERFNVPROC)(GLenum pname, GLfloat param);
+	typedef void (APIENTRY* PFNGLCOMBINERPARAMETERIVNVPROC)(GLenum pname, const GLint* params);
+	typedef void (APIENTRY* PFNGLCOMBINERPARAMETERINVPROC)(GLenum pname, GLint param);
+	typedef void (APIENTRY* PFNGLCOMBINERINPUTNVPROC)(GLenum stage, GLenum portion, GLenum variable, GLenum input, GLenum mapping, GLenum componentUsage);
+	typedef void (APIENTRY* PFNGLCOMBINEROUTPUTNVPROC)(GLenum stage, GLenum portion, GLenum abOutput, GLenum cdOutput, GLenum sumOutput, GLenum scale, GLenum bias, GLboolean abDotProduct, GLboolean cdDotProduct, GLboolean muxSum);
+	typedef void (APIENTRY* PFNGLFINALCOMBINERINPUTNVPROC)(GLenum variable, GLenum input, GLenum mapping, GLenum componentUsage);
+	typedef void (APIENTRY* PFNGLGETCOMBINERINPUTPARAMETERFVNVPROC)(GLenum stage, GLenum portion, GLenum variable, GLenum pname, GLfloat* params);
+	typedef void (APIENTRY* PFNGLGETCOMBINERINPUTPARAMETERIVNVPROC)(GLenum stage, GLenum portion, GLenum variable, GLenum pname, GLint* params);
+	typedef void (APIENTRY* PFNGLGETCOMBINEROUTPUTPARAMETERFVNVPROC)(GLenum stage, GLenum portion, GLenum pname, GLfloat* params);
+	typedef void (APIENTRY* PFNGLGETCOMBINEROUTPUTPARAMETERIVNVPROC)(GLenum stage, GLenum portion, GLenum pname, GLint* params);
+	typedef void (APIENTRY* PFNGLGETFINALCOMBINERINPUTPARAMETERFVNVPROC)(GLenum variable, GLenum pname, GLfloat* params);
+	typedef void (APIENTRY* PFNGLGETFINALCOMBINERINPUTPARAMETERIVNVPROC)(GLenum variable, GLenum pname, GLint* params);
+#endif
+
+#ifndef GL_NV_register_combiners2
+#define GL_NV_register_combiners2 1
+#ifdef GL_GLEXT_PROTOTYPES
+	extern void glCombinerStageParameterfvNV(GLenum stage, GLenum pname, const GLfloat* params);
+	extern void glGetCombinerStageParameterfvNV(GLenum stage, GLenum pname, GLfloat* params);
+#endif
+	typedef void (APIENTRY* PFNGLCOMBINERSTAGEPARAMETERFVNVPROC)(GLenum stage, GLenum pname, const GLfloat* params);
+	typedef void (APIENTRY* PFNGLGETCOMBINERSTAGEPARAMETERFVNVPROC)(GLenum stage, GLenum pname, GLfloat* params);
+#endif
+
+#ifndef GL_NV_stencil_two_side
+#define GL_NV_stencil_two_side 1
+#ifdef GL_GLEXT_PROTOTYPES
+	extern void APIENTRY glActiveStencilFaceNV(GLenum face);
+#endif
+	typedef void (APIENTRY* PFNGLACTIVESTENCILFACENVPROC)(GLenum face);
+#endif
+
+#ifndef GL_NV_texgen_emboss
+#define GL_NV_texgen_emboss 1
+#endif
+
+#ifndef GL_NV_texgen_reflection
+#define GL_NV_texgen_reflection 1
+#endif
+
+#ifndef GL_NV_texture_compression_vtc
+#define GL_NV_texture_compression_vtc 1
+#endif
+
+#ifndef GL_NV_texture_env_combine4
+#define GL_NV_texture_env_combine4 1
+#endif
+
+#ifndef GL_NV_texture_rectangle
+#define GL_NV_texture_rectangle 1
+#endif
+
+#ifndef GL_NV_texture_shader
+#define GL_NV_texture_shader 1
+#endif
+
+#ifndef GL_NV_texture_shader2
+#define GL_NV_texture_shader2 1
+#endif
+
+#ifndef GL_NV_texture_shader3
+#define GL_NV_texture_shader3 1
+#endif
+
+#ifndef GL_NV_vertex_array_range
+#define GL_NV_vertex_array_range 1
+#ifdef GL_GLEXT_PROTOTYPES
+	extern void APIENTRY glFlushVertexArrayRangeNV(void);
+	extern void APIENTRY glVertexArrayRangeNV(GLsizei, const GLvoid*);
+#endif /* GL_GLEXT_PROTOTYPES */
+	typedef void (APIENTRY* PFNGLFLUSHVERTEXARRAYRANGENVPROC)(void);
+	typedef void (APIENTRY* PFNGLVERTEXARRAYRANGENVPROC)(GLsizei size, const GLvoid* pointer);
+#endif
+
+#ifndef GL_NV_vertex_array_range2
+#define GL_NV_vertex_array_range2 1
+#endif
+
+#ifndef GL_NV_vertex_program
+#define GL_NV_vertex_program 1
+#ifdef GL_GLEXT_PROTOTYPES
+	extern void glBindProgramNV(GLenum target, GLuint id);
+	extern void glDeleteProgramsNV(GLsizei n, const GLuint* ids);
+	extern void glExecuteProgramNV(GLenum target, GLuint id, const GLfloat* params);
+	extern void glGenProgramsNV(GLsizei n, GLuint* ids);
+	extern GLboolean glAreProgramsResidentNV(GLsizei n, const GLuint* ids, boolean* residences);
+	extern void glRequestResidentProgramsNV(GLsizei n, GLuint* ids);
+	extern void glGetProgramParameterfvNV(GLenum target, GLuint index, GLenum pname, GLfloat* params);
+	extern void glGetProgramParameterdvNV(GLenum target, GLuint index, GLenum pname, GLdouble* params);
+	extern void glGetProgramivNV(GLuint id, GLenum pname, int* params);
+	extern void glGetProgramStringNV(GLuint id, GLenum pname, GLubyte* program);
+	extern void glGetTrackMatrixivNV(GLenum target, GLuint address, GLenum pname, int* params);
+	extern void glGetVertexAttribdvNV(GLuint index, GLenum pname, GLdouble* params);
+	extern void glGetVertexAttribfvNV(GLuint index, GLenum pname, GLfloat* params);
+	extern void glGetVertexAttribivNV(GLuint index, GLenum pname, int* params);
+	extern void glGetVertexAttribPointervNV(GLuint index, GLenum pname, void** pointer);
+	extern GLboolean glIsProgramNV(GLuint id);
+	extern void glLoadProgramNV(GLenum target, GLuint id, GLsizei len, const GLubyte* program);
+	extern void glProgramParameter4fNV(GLenum target, GLuint index, GLfloat x, GLfloat y, GLfloat z, GLfloat w);
+	extern void glProgramParameter4dNV(GLenum target, GLuint index, GLdouble x, GLdouble y, GLdouble z, GLdouble w);
+	extern void glProgramParameter4dvNV(GLenum target, GLuint index, const GLdouble* params);
+	extern void glProgramParameter4fvNV(GLenum target, GLuint index, const GLfloat* params);
+	extern void glProgramParameters4dvNV(GLenum target, GLuint index, GLuint num, const GLdouble* params);
+	extern void glProgramParameters4fvNV(GLenum target, GLuint index, GLuint num, const GLfloat* params);
+	extern void glTrackMatrixNV(GLenum target, GLuint address, GLenum matrix, GLenum transform);
+	extern void glVertexAttribPointerNV(GLuint index, int size, GLenum type, GLsizei stride, const void* pointer);
+	extern void glVertexAttrib1sNV(GLuint index, GLshort x);
+	extern void glVertexAttrib1fNV(GLuint index, GLfloat x);
+	extern void glVertexAttrib1dNV(GLuint index, GLdouble x);
+	extern void glVertexAttrib2sNV(GLuint index, GLshort x, GLshort y);
+	extern void glVertexAttrib2fNV(GLuint index, GLfloat x, GLfloat y);
+	extern void glVertexAttrib2dNV(GLuint index, GLdouble x, GLdouble y);
+	extern void glVertexAttrib3sNV(GLuint index, GLshort x, GLshort y, GLshort z);
+	extern void glVertexAttrib3fNV(GLuint index, GLfloat x, GLfloat y, GLfloat z);
+	extern void glVertexAttrib3dNV(GLuint index, GLdouble x, GLdouble y, GLdouble z);
+	extern void glVertexAttrib4sNV(GLuint index, GLshort x, GLshort y, GLshort z, GLshort w);
+	extern void glVertexAttrib4fNV(GLuint index, GLfloat x, GLfloat y, GLfloat z, GLfloat w);
+	extern void glVertexAttrib4dNV(GLuint index, GLdouble x, GLdouble y, GLdouble z, GLdouble w);
+	extern void glVertexAttrib4ubNV(GLuint index, GLubyte x, GLubyte y, GLubyte z, GLubyte w);
+	extern void glVertexAttrib1svNV(GLuint index, const GLshort* v);
+	extern void glVertexAttrib1fvNV(GLuint index, const GLfloat* v);
+	extern void glVertexAttrib1dvNV(GLuint index, const GLdouble* v);
+	extern void glVertexAttrib2svNV(GLuint index, const GLshort* v);
+	extern void glVertexAttrib2fvNV(GLuint index, const GLfloat* v);
+	extern void glVertexAttrib2dvNV(GLuint index, const GLdouble* v);
+	extern void glVertexAttrib3svNV(GLuint index, const GLshort* v);
+	extern void glVertexAttrib3fvNV(GLuint index, const GLfloat* v);
+	extern void glVertexAttrib3dvNV(GLuint index, const GLdouble* v);
+	extern void glVertexAttrib4svNV(GLuint index, const GLshort* v);
+	extern void glVertexAttrib4fvNV(GLuint index, const GLfloat* v);
+	extern void glVertexAttrib4dvNV(GLuint index, const GLdouble* v);
+	extern void glVertexAttrib4ubvNV(GLuint index, const GLubyte* v);
+	extern void glVertexAttribs1svNV(GLuint index, GLsizei n, const GLshort* v);
+	extern void glVertexAttribs1fvNV(GLuint index, GLsizei n, const GLfloat* v);
+	extern void glVertexAttribs1dvNV(GLuint index, GLsizei n, const GLdouble* v);
+	extern void glVertexAttribs2svNV(GLuint index, GLsizei n, const GLshort* v);
+	extern void glVertexAttribs2fvNV(GLuint index, GLsizei n, const GLfloat* v);
+	extern void glVertexAttribs2dvNV(GLuint index, GLsizei n, const GLdouble* v);
+	extern void glVertexAttribs3svNV(GLuint index, GLsizei n, const GLshort* v);
+	extern void glVertexAttribs3fvNV(GLuint index, GLsizei n, const GLfloat* v);
+	extern void glVertexAttribs3dvNV(GLuint index, GLsizei n, const GLdouble* v);
+	extern void glVertexAttribs4svNV(GLuint index, GLsizei n, const GLshort* v);
+	extern void glVertexAttribs4fvNV(GLuint index, GLsizei n, const GLfloat* v);
+	extern void glVertexAttribs4dvNV(GLuint index, GLsizei n, const GLdouble* v);
+	extern void glVertexAttribs4ubvNV(GLuint index, GLsizei n, const GLubyte* v);
+#endif
+	typedef GLboolean(APIENTRY* PFNGLAREPROGRAMSRESIDENTNVPROC)(GLsizei n, const GLuint* programs, GLboolean* residences);
+	typedef void (APIENTRY* PFNGLBINDPROGRAMNVPROC)(GLenum target, GLuint id);
+	typedef void (APIENTRY* PFNGLDELETEPROGRAMSNVPROC)(GLsizei n, const GLuint* programs);
+	typedef void (APIENTRY* PFNGLEXECUTEPROGRAMNVPROC)(GLenum target, GLuint id, const GLfloat* params);
+	typedef void (APIENTRY* PFNGLGENPROGRAMSNVPROC)(GLsizei n, GLuint* programs);
+	typedef void (APIENTRY* PFNGLGETPROGRAMPARAMETERDVNVPROC)(GLenum target, GLuint index, GLenum pname, GLdouble* params);
+	typedef void (APIENTRY* PFNGLGETPROGRAMPARAMETERFVNVPROC)(GLenum target, GLuint index, GLenum pname, GLfloat* params);
+	typedef void (APIENTRY* PFNGLGETPROGRAMIVNVPROC)(GLuint id, GLenum pname, GLint* params);
+	typedef void (APIENTRY* PFNGLGETPROGRAMSTRINGNVPROC)(GLuint id, GLenum pname, GLubyte* program);
+	typedef void (APIENTRY* PFNGLGETTRACKMATRIXIVNVPROC)(GLenum target, GLuint address, GLenum pname, GLint* params);
+	typedef void (APIENTRY* PFNGLGETVERTEXATTRIBDVNVPROC)(GLuint index, GLenum pname, GLdouble* params);
+	typedef void (APIENTRY* PFNGLGETVERTEXATTRIBFVNVPROC)(GLuint index, GLenum pname, GLfloat* params);
+	typedef void (APIENTRY* PFNGLGETVERTEXATTRIBIVNVPROC)(GLuint index, GLenum pname, GLint* params);
+	typedef void (APIENTRY* PFNGLGETVERTEXATTRIBPOINTERVNVPROC)(GLuint index, GLenum pname, GLvoid* *pointer);
+	typedef GLboolean(APIENTRY* PFNGLISPROGRAMNVPROC)(GLuint id);
+	typedef void (APIENTRY* PFNGLLOADPROGRAMNVPROC)(GLenum target, GLuint id, GLsizei len, const GLubyte* program);
+	typedef void (APIENTRY* PFNGLPROGRAMPARAMETER4DNVPROC)(GLenum target, GLuint index, GLdouble x, GLdouble y, GLdouble z, GLdouble w);
+	typedef void (APIENTRY* PFNGLPROGRAMPARAMETER4DVNVPROC)(GLenum target, GLuint index, const GLdouble* v);
+	typedef void (APIENTRY* PFNGLPROGRAMPARAMETER4FNVPROC)(GLenum target, GLuint index, GLfloat x, GLfloat y, GLfloat z, GLfloat w);
+	typedef void (APIENTRY* PFNGLPROGRAMPARAMETER4FVNVPROC)(GLenum target, GLuint index, const GLfloat* v);
+	typedef void (APIENTRY* PFNGLPROGRAMPARAMETERS4DVNVPROC)(GLenum target, GLuint index, GLsizei count, const GLdouble* v);
+	typedef void (APIENTRY* PFNGLPROGRAMPARAMETERS4FVNVPROC)(GLenum target, GLuint index, GLsizei count, const GLfloat* v);
+	typedef void (APIENTRY* PFNGLREQUESTRESIDENTPROGRAMSNVPROC)(GLsizei n, const GLuint* programs);
+	typedef void (APIENTRY* PFNGLTRACKMATRIXNVPROC)(GLenum target, GLuint address, GLenum matrix, GLenum transform);
+	typedef void (APIENTRY* PFNGLVERTEXATTRIBPOINTERNVPROC)(GLuint index, GLint fsize, GLenum type, GLsizei stride, const GLvoid* pointer);
+	typedef void (APIENTRY* PFNGLVERTEXATTRIB1DNVPROC)(GLuint index, GLdouble x);
+	typedef void (APIENTRY* PFNGLVERTEXATTRIB1DVNVPROC)(GLuint index, const GLdouble* v);
+	typedef void (APIENTRY* PFNGLVERTEXATTRIB1FNVPROC)(GLuint index, GLfloat x);
+	typedef void (APIENTRY* PFNGLVERTEXATTRIB1FVNVPROC)(GLuint index, const GLfloat* v);
+	typedef void (APIENTRY* PFNGLVERTEXATTRIB1SNVPROC)(GLuint index, GLshort x);
+	typedef void (APIENTRY* PFNGLVERTEXATTRIB1SVNVPROC)(GLuint index, const GLshort* v);
+	typedef void (APIENTRY* PFNGLVERTEXATTRIB2DNVPROC)(GLuint index, GLdouble x, GLdouble y);
+	typedef void (APIENTRY* PFNGLVERTEXATTRIB2DVNVPROC)(GLuint index, const GLdouble* v);
+	typedef void (APIENTRY* PFNGLVERTEXATTRIB2FNVPROC)(GLuint index, GLfloat x, GLfloat y);
+	typedef void (APIENTRY* PFNGLVERTEXATTRIB2FVNVPROC)(GLuint index, const GLfloat* v);
+	typedef void (APIENTRY* PFNGLVERTEXATTRIB2SNVPROC)(GLuint index, GLshort x, GLshort y);
+	typedef void (APIENTRY* PFNGLVERTEXATTRIB2SVNVPROC)(GLuint index, const GLshort* v);
+	typedef void (APIENTRY* PFNGLVERTEXATTRIB3DNVPROC)(GLuint index, GLdouble x, GLdouble y, GLdouble z);
+	typedef void (APIENTRY* PFNGLVERTEXATTRIB3DVNVPROC)(GLuint index, const GLdouble* v);
+	typedef void (APIENTRY* PFNGLVERTEXATTRIB3FNVPROC)(GLuint index, GLfloat x, GLfloat y, GLfloat z);
+	typedef void (APIENTRY* PFNGLVERTEXATTRIB3FVNVPROC)(GLuint index, const GLfloat* v);
+	typedef void (APIENTRY* PFNGLVERTEXATTRIB3SNVPROC)(GLuint index, GLshort x, GLshort y, GLshort z);
+	typedef void (APIENTRY* PFNGLVERTEXATTRIB3SVNVPROC)(GLuint index, const GLshort* v);
+	typedef void (APIENTRY* PFNGLVERTEXATTRIB4DNVPROC)(GLuint index, GLdouble x, GLdouble y, GLdouble z, GLdouble w);
+	typedef void (APIENTRY* PFNGLVERTEXATTRIB4DVNVPROC)(GLuint index, const GLdouble* v);
+	typedef void (APIENTRY* PFNGLVERTEXATTRIB4FNVPROC)(GLuint index, GLfloat x, GLfloat y, GLfloat z, GLfloat w);
+	typedef void (APIENTRY* PFNGLVERTEXATTRIB4FVNVPROC)(GLuint index, const GLfloat* v);
+	typedef void (APIENTRY* PFNGLVERTEXATTRIB4SNVPROC)(GLuint index, GLshort x, GLshort y, GLshort z, GLshort w);
+	typedef void (APIENTRY* PFNGLVERTEXATTRIB4SVNVPROC)(GLuint index, const GLshort* v);
+	typedef void (APIENTRY* PFNGLVERTEXATTRIB4UBNVPROC)(GLuint index, GLubyte x, GLubyte y, GLubyte z, GLubyte w);
+	typedef void (APIENTRY* PFNGLVERTEXATTRIB4UBVNVPROC)(GLuint index, const GLubyte* v);
+	typedef void (APIENTRY* PFNGLVERTEXATTRIBS1DVNVPROC)(GLuint index, GLsizei count, const GLdouble* v);
+	typedef void (APIENTRY* PFNGLVERTEXATTRIBS1FVNVPROC)(GLuint index, GLsizei count, const GLfloat* v);
+	typedef void (APIENTRY* PFNGLVERTEXATTRIBS1SVNVPROC)(GLuint index, GLsizei count, const GLshort* v);
+	typedef void (APIENTRY* PFNGLVERTEXATTRIBS2DVNVPROC)(GLuint index, GLsizei count, const GLdouble* v);
+	typedef void (APIENTRY* PFNGLVERTEXATTRIBS2FVNVPROC)(GLuint index, GLsizei count, const GLfloat* v);
+	typedef void (APIENTRY* PFNGLVERTEXATTRIBS2SVNVPROC)(GLuint index, GLsizei count, const GLshort* v);
+	typedef void (APIENTRY* PFNGLVERTEXATTRIBS3DVNVPROC)(GLuint index, GLsizei count, const GLdouble* v);
+	typedef void (APIENTRY* PFNGLVERTEXATTRIBS3FVNVPROC)(GLuint index, GLsizei count, const GLfloat* v);
+	typedef void (APIENTRY* PFNGLVERTEXATTRIBS3SVNVPROC)(GLuint index, GLsizei count, const GLshort* v);
+	typedef void (APIENTRY* PFNGLVERTEXATTRIBS4DVNVPROC)(GLuint index, GLsizei count, const GLdouble* v);
+	typedef void (APIENTRY* PFNGLVERTEXATTRIBS4FVNVPROC)(GLuint index, GLsizei count, const GLfloat* v);
+	typedef void (APIENTRY* PFNGLVERTEXATTRIBS4SVNVPROC)(GLuint index, GLsizei count, const GLshort* v);
+	typedef void (APIENTRY* PFNGLVERTEXATTRIBS4UBVNVPROC)(GLuint index, GLsizei count, const GLubyte* v);
+#endif
+
+#ifndef GL_NV_vertex_program1_1
+#define GL_NV_vertex_program1_1 1
+#endif
+
+#ifndef GL_NV_vertex_program2
+#define GL_NV_vertex_program2 1
+#endif
+
+#ifndef GL_SGIS_generate_mipmap
+#define GL_SGIS_generate_mipmap 1
+#endif
+
+#ifndef GL_SGIS_texture_lod
+#define GL_SGIS_texture_lod 1
+#endif
+
+#ifndef GL_SGIX_depth_texture
+#define GL_SGIX_depth_texture 1
+#endif
+
+#ifndef GL_SGIX_shadow
+#define GL_SGIX_shadow 1
+#endif
+
+#ifdef __cplusplus
+}
+#endif
+
+#endif
+
diff --git a/APEX_1.4/shared/external/include/GL/glut.h b/APEX_1.4/shared/external/include/GL/glut.h
new file mode 100644
index 00000000..77830e3c
--- /dev/null
+++ b/APEX_1.4/shared/external/include/GL/glut.h
@@ -0,0 +1,740 @@
+/*
+ * Copyright (c) 2008-2015, NVIDIA CORPORATION.  All rights reserved.
+ *
+ * NVIDIA CORPORATION and its licensors retain all intellectual property
+ * and proprietary rights in and to this software, related documentation
+ * and any modifications thereto.  Any use, reproduction, disclosure or
+ * distribution of this software and related documentation without an express
+ * license agreement from NVIDIA CORPORATION is strictly prohibited.
+ */
+
+
+#ifndef __glut_h__
+#define __glut_h__
+
+/* Copyright (c) Mark J. Kilgard, 1994, 1995, 1996, 1998. */
+
+/* This program is freely distributable without licensing fees  and is
+   provided without guarantee or warrantee expressed or  implied. This
+   program is -not- in the public domain. */
+
+#if defined(_WIN32)
+
+/* GLUT 3.7 now tries to avoid including <windows.h>
+   to avoid name space pollution, but Win32's <GL/gl.h>
+   needs APIENTRY and WINGDIAPI defined properly. */
+# if 0
+/* This would put tons of macros and crap in our clean name space. */
+#  define  WIN32_LEAN_AND_MEAN
+#  include <windows.h>
+# else
+/* XXX This is from Win32's <windef.h> */
+#  ifndef APIENTRY
+#   define GLUT_APIENTRY_DEFINED
+#   if (_MSC_VER >= 800) || defined(_STDCALL_SUPPORTED) || defined(__BORLANDC__) || defined(__LCC__)
+#    define APIENTRY    __stdcall
+#   else
+#    define APIENTRY
+#   endif
+#  endif
+/* XXX This is from Win32's <winnt.h> */
+#  ifndef CALLBACK
+#   if (defined(_M_MRX000) || defined(_M_IX86) || defined(_M_ALPHA) || defined(_M_PPC)) && !defined(MIDL_PASS) || defined(__LCC__)
+#    define CALLBACK __stdcall
+#   else
+#    define CALLBACK
+#   endif
+#  endif
+/* XXX Hack for lcc compiler.  It doesn't support __declspec(dllimport), just __stdcall. */
+#  if defined( __LCC__ )
+#   undef WINGDIAPI
+#   define WINGDIAPI __stdcall
+#  else
+/* XXX This is from Win32's <wingdi.h> and <winnt.h> */
+#   ifndef WINGDIAPI
+#    define GLUT_WINGDIAPI_DEFINED
+#    define WINGDIAPI __declspec(dllimport)
+#   endif
+#  endif
+/* XXX This is from Win32's <ctype.h> */
+#  ifndef _WCHAR_T_DEFINED
+typedef unsigned short wchar_t;
+#   define _WCHAR_T_DEFINED
+#  endif
+# endif
+
+/* To disable automatic library usage for GLUT, define GLUT_NO_LIB_PRAGMA
+   in your compile preprocessor options. */
+# if !defined(GLUT_BUILDING_LIB) && !defined(GLUT_NO_LIB_PRAGMA)
+#  pragma comment (lib, "winmm.lib")      /* link with Windows MultiMedia lib */
+/* To enable automatic SGI OpenGL for Windows library usage for GLUT,
+   define GLUT_USE_SGI_OPENGL in your compile preprocessor options.  */
+#  ifdef GLUT_USE_SGI_OPENGL
+#   pragma comment (lib, "opengl.lib")    /* link with SGI OpenGL for Windows lib */
+#   pragma comment (lib, "glu.lib")       /* link with SGI OpenGL Utility lib */
+#   pragma comment (lib, "glut.lib")      /* link with Win32 GLUT for SGI OpenGL lib */
+#  else
+#   pragma comment (lib, "opengl32.lib")  /* link with Microsoft OpenGL lib */
+#   pragma comment (lib, "glu32.lib")     /* link with Microsoft OpenGL Utility lib */
+#   pragma comment (lib, "glut32.lib")    /* link with Win32 GLUT lib */
+#  endif
+# endif
+
+/* To disable supression of annoying warnings about floats being promoted
+   to doubles, define GLUT_NO_WARNING_DISABLE in your compile preprocessor
+   options. */
+# ifndef GLUT_NO_WARNING_DISABLE
+#  pragma warning (disable:4244)  /* Disable bogus VC++ 4.2 conversion warnings. */
+#  pragma warning (disable:4305)  /* VC++ 5.0 version of above warning. */
+# endif
+
+/* Win32 has an annoying issue where there are multiple C run-time
+   libraries (CRTs).  If the executable is linked with a different CRT
+   from the GLUT DLL, the GLUT DLL will not share the same CRT static
+   data seen by the executable.  In particular, atexit callbacks registered
+   in the executable will not be called if GLUT calls its (different)
+   exit routine).  GLUT is typically built with the
+   "/MD" option (the CRT with multithreading DLL support), but the Visual
+   C++ linker default is "/ML" (the single threaded CRT).
+
+   One workaround to this issue is requiring users to always link with
+   the same CRT as GLUT is compiled with.  That requires users supply a
+   non-standard option.  GLUT 3.7 has its own built-in workaround where
+   the executable's "exit" function pointer is covertly passed to GLUT.
+   GLUT then calls the executable's exit function pointer to ensure that
+   any "atexit" calls registered by the application are called if GLUT
+   needs to exit.
+
+   Note that the __glut*WithExit routines should NEVER be called directly.
+   To avoid the atexit workaround, #define GLUT_DISABLE_ATEXIT_HACK. */
+
+/* XXX This is from Win32's <process.h> */
+# if !defined(_MSC_VER) && !defined(__cdecl)
+/* Define __cdecl for non-Microsoft compilers. */
+#  define __cdecl
+#  define GLUT_DEFINED___CDECL
+# endif
+# ifndef _CRTIMP
+#  ifdef _NTSDK
+/* Definition compatible with NT SDK */
+#   define _CRTIMP
+#  else
+/* Current definition */
+#   ifdef _DLL
+#    define _CRTIMP __declspec(dllimport)
+#   else
+#    define _CRTIMP
+#   endif
+#  endif
+#  define GLUT_DEFINED__CRTIMP
+# endif
+
+/* GLUT API entry point declarations for Win32. */
+# ifdef GLUT_BUILDING_LIB
+#  define GLUTAPI __declspec(dllexport)
+# else
+#  ifdef _DLL
+#   define GLUTAPI __declspec(dllimport)
+#  else
+#   define GLUTAPI extern
+#  endif
+# endif
+
+/* GLUT callback calling convention for Win32. */
+# define GLUTCALLBACK __cdecl
+
+#endif  /* _WIN32 */
+
+#include <GL/gl.h>
+#include <GL/glu.h>
+
+#ifdef __cplusplus
+extern "C" {
+#endif
+
+#if defined(_WIN32)
+# ifndef GLUT_BUILDING_LIB
+#if _MSC_VER > 1200
+	extern _CRTIMP __declspec(noreturn) void   __cdecl exit(int);
+#else
+	extern _CRTIMP void __cdecl exit(int);
+#endif
+# endif
+#else
+	/* non-Win32 case. */
+	/* Define APIENTRY and CALLBACK to nothing if we aren't on Win32. */
+# define APIENTRY
+# define GLUT_APIENTRY_DEFINED
+# define CALLBACK
+	/* Define GLUTAPI and GLUTCALLBACK as below if we aren't on Win32. */
+# define GLUTAPI extern
+# define GLUTCALLBACK
+	/* Prototype exit for the non-Win32 case (see above). */
+	extern void exit(int);
+#endif
+
+	/**
+	 GLUT API revision history:
+
+	 GLUT_API_VERSION is updated to reflect incompatible GLUT
+	 API changes (interface changes, semantic changes, deletions,
+	 or additions).
+
+	 GLUT_API_VERSION=1  First public release of GLUT.  11/29/94
+
+	 GLUT_API_VERSION=2  Added support for OpenGL/GLX multisampling,
+	 extension.  Supports new input devices like tablet, dial and button
+	 box, and Spaceball.  Easy to query OpenGL extensions.
+
+	 GLUT_API_VERSION=3  glutMenuStatus added.
+
+	 GLUT_API_VERSION=4  glutInitDisplayString, glutWarpPointer,
+	 glutBitmapLength, glutStrokeLength, glutWindowStatusFunc, dynamic
+	 video resize subAPI, glutPostWindowRedisplay, glutKeyboardUpFunc,
+	 glutSpecialUpFunc, glutIgnoreKeyRepeat, glutSetKeyRepeat,
+	 glutJoystickFunc, glutForceJoystickFunc (NOT FINALIZED!).
+	**/
+#ifndef GLUT_API_VERSION  /* allow this to be overriden */
+#define GLUT_API_VERSION		3
+#endif
+
+	/**
+	 GLUT implementation revision history:
+
+	 GLUT_XLIB_IMPLEMENTATION is updated to reflect both GLUT
+	 API revisions and implementation revisions (ie, bug fixes).
+
+	 GLUT_XLIB_IMPLEMENTATION=1  mjk's first public release of
+	 GLUT Xlib-based implementation.  11/29/94
+
+	 GLUT_XLIB_IMPLEMENTATION=2  mjk's second public release of
+	 GLUT Xlib-based implementation providing GLUT version 2
+	 interfaces.
+
+	 GLUT_XLIB_IMPLEMENTATION=3  mjk's GLUT 2.2 images. 4/17/95
+
+	 GLUT_XLIB_IMPLEMENTATION=4  mjk's GLUT 2.3 images. 6/?/95
+
+	 GLUT_XLIB_IMPLEMENTATION=5  mjk's GLUT 3.0 images. 10/?/95
+
+	 GLUT_XLIB_IMPLEMENTATION=7  mjk's GLUT 3.1+ with glutWarpPoitner.  7/24/96
+
+	 GLUT_XLIB_IMPLEMENTATION=8  mjk's GLUT 3.1+ with glutWarpPoitner
+	 and video resize.  1/3/97
+
+	 GLUT_XLIB_IMPLEMENTATION=9 mjk's GLUT 3.4 release with early GLUT 4 routines.
+
+	 GLUT_XLIB_IMPLEMENTATION=11 Mesa 2.5's GLUT 3.6 release.
+
+	 GLUT_XLIB_IMPLEMENTATION=12 mjk's GLUT 3.6 release with early GLUT 4 routines + signal handling.
+
+	 GLUT_XLIB_IMPLEMENTATION=13 mjk's GLUT 3.7 beta with GameGLUT support.
+
+	 GLUT_XLIB_IMPLEMENTATION=14 mjk's GLUT 3.7 beta with f90gl friend interface.
+
+	 GLUT_XLIB_IMPLEMENTATION=15 mjk's GLUT 3.7 beta sync'ed with Mesa <GL/glut.h>
+	**/
+#ifndef GLUT_XLIB_IMPLEMENTATION  /* Allow this to be overriden. */
+#define GLUT_XLIB_IMPLEMENTATION	15
+#endif
+
+	/* Display mode bit masks. */
+#define GLUT_RGB			0
+#define GLUT_RGBA			GLUT_RGB
+#define GLUT_INDEX			1
+#define GLUT_SINGLE			0
+#define GLUT_DOUBLE			2
+#define GLUT_ACCUM			4
+#define GLUT_ALPHA			8
+#define GLUT_DEPTH			16
+#define GLUT_STENCIL			32
+#if (GLUT_API_VERSION >= 2)
+#define GLUT_MULTISAMPLE		128
+#define GLUT_STEREO			256
+#endif
+#if (GLUT_API_VERSION >= 3)
+#define GLUT_LUMINANCE			512
+#endif
+
+	/* Mouse buttons. */
+#define GLUT_LEFT_BUTTON		0
+#define GLUT_MIDDLE_BUTTON		1
+#define GLUT_RIGHT_BUTTON		2
+
+	/* Mouse button  state. */
+#define GLUT_DOWN			0
+#define GLUT_UP				1
+
+#if (GLUT_API_VERSION >= 2)
+	/* function keys */
+#define GLUT_KEY_F1			1
+#define GLUT_KEY_F2			2
+#define GLUT_KEY_F3			3
+#define GLUT_KEY_F4			4
+#define GLUT_KEY_F5			5
+#define GLUT_KEY_F6			6
+#define GLUT_KEY_F7			7
+#define GLUT_KEY_F8			8
+#define GLUT_KEY_F9			9
+#define GLUT_KEY_F10			10
+#define GLUT_KEY_F11			11
+#define GLUT_KEY_F12			12
+	/* directional keys */
+#define GLUT_KEY_LEFT			100
+#define GLUT_KEY_UP			101
+#define GLUT_KEY_RIGHT			102
+#define GLUT_KEY_DOWN			103
+#define GLUT_KEY_PAGE_UP		104
+#define GLUT_KEY_PAGE_DOWN		105
+#define GLUT_KEY_HOME			106
+#define GLUT_KEY_END			107
+#define GLUT_KEY_INSERT			108
+#endif
+
+	/* Entry/exit  state. */
+#define GLUT_LEFT			0
+#define GLUT_ENTERED			1
+
+	/* Menu usage  state. */
+#define GLUT_MENU_NOT_IN_USE		0
+#define GLUT_MENU_IN_USE		1
+
+	/* Visibility  state. */
+#define GLUT_NOT_VISIBLE		0
+#define GLUT_VISIBLE			1
+
+	/* Window status  state. */
+#define GLUT_HIDDEN			0
+#define GLUT_FULLY_RETAINED		1
+#define GLUT_PARTIALLY_RETAINED		2
+#define GLUT_FULLY_COVERED		3
+
+	/* Color index component selection values. */
+#define GLUT_RED			0
+#define GLUT_GREEN			1
+#define GLUT_BLUE			2
+
+#if defined(_WIN32)
+	/* Stroke font constants (use these in GLUT program). */
+#define GLUT_STROKE_ROMAN		((void*)0)
+#define GLUT_STROKE_MONO_ROMAN		((void*)1)
+
+	/* Bitmap font constants (use these in GLUT program). */
+#define GLUT_BITMAP_9_BY_15		((void*)2)
+#define GLUT_BITMAP_8_BY_13		((void*)3)
+#define GLUT_BITMAP_TIMES_ROMAN_10	((void*)4)
+#define GLUT_BITMAP_TIMES_ROMAN_24	((void*)5)
+#if (GLUT_API_VERSION >= 3)
+#define GLUT_BITMAP_HELVETICA_10	((void*)6)
+#define GLUT_BITMAP_HELVETICA_12	((void*)7)
+#define GLUT_BITMAP_HELVETICA_18	((void*)8)
+#endif
+#else
+	/* Stroke font opaque addresses (use constants instead in source code). */
+	GLUTAPI void* glutStrokeRoman;
+	GLUTAPI void* glutStrokeMonoRoman;
+
+	/* Stroke font constants (use these in GLUT program). */
+#define GLUT_STROKE_ROMAN		(&glutStrokeRoman)
+#define GLUT_STROKE_MONO_ROMAN		(&glutStrokeMonoRoman)
+
+	/* Bitmap font opaque addresses (use constants instead in source code). */
+	GLUTAPI void* glutBitmap9By15;
+	GLUTAPI void* glutBitmap8By13;
+	GLUTAPI void* glutBitmapTimesRoman10;
+	GLUTAPI void* glutBitmapTimesRoman24;
+	GLUTAPI void* glutBitmapHelvetica10;
+	GLUTAPI void* glutBitmapHelvetica12;
+	GLUTAPI void* glutBitmapHelvetica18;
+
+	/* Bitmap font constants (use these in GLUT program). */
+#define GLUT_BITMAP_9_BY_15		(&glutBitmap9By15)
+#define GLUT_BITMAP_8_BY_13		(&glutBitmap8By13)
+#define GLUT_BITMAP_TIMES_ROMAN_10	(&glutBitmapTimesRoman10)
+#define GLUT_BITMAP_TIMES_ROMAN_24	(&glutBitmapTimesRoman24)
+#if (GLUT_API_VERSION >= 3)
+#define GLUT_BITMAP_HELVETICA_10	(&glutBitmapHelvetica10)
+#define GLUT_BITMAP_HELVETICA_12	(&glutBitmapHelvetica12)
+#define GLUT_BITMAP_HELVETICA_18	(&glutBitmapHelvetica18)
+#endif
+#endif
+
+	/* glutGet parameters. */
+#define GLUT_WINDOW_X			((GLenum) 100)
+#define GLUT_WINDOW_Y			((GLenum) 101)
+#define GLUT_WINDOW_WIDTH		((GLenum) 102)
+#define GLUT_WINDOW_HEIGHT		((GLenum) 103)
+#define GLUT_WINDOW_BUFFER_SIZE		((GLenum) 104)
+#define GLUT_WINDOW_STENCIL_SIZE	((GLenum) 105)
+#define GLUT_WINDOW_DEPTH_SIZE		((GLenum) 106)
+#define GLUT_WINDOW_RED_SIZE		((GLenum) 107)
+#define GLUT_WINDOW_GREEN_SIZE		((GLenum) 108)
+#define GLUT_WINDOW_BLUE_SIZE		((GLenum) 109)
+#define GLUT_WINDOW_ALPHA_SIZE		((GLenum) 110)
+#define GLUT_WINDOW_ACCUM_RED_SIZE	((GLenum) 111)
+#define GLUT_WINDOW_ACCUM_GREEN_SIZE	((GLenum) 112)
+#define GLUT_WINDOW_ACCUM_BLUE_SIZE	((GLenum) 113)
+#define GLUT_WINDOW_ACCUM_ALPHA_SIZE	((GLenum) 114)
+#define GLUT_WINDOW_DOUBLEBUFFER	((GLenum) 115)
+#define GLUT_WINDOW_RGBA		((GLenum) 116)
+#define GLUT_WINDOW_PARENT		((GLenum) 117)
+#define GLUT_WINDOW_NUM_CHILDREN	((GLenum) 118)
+#define GLUT_WINDOW_COLORMAP_SIZE	((GLenum) 119)
+#if (GLUT_API_VERSION >= 2)
+#define GLUT_WINDOW_NUM_SAMPLES		((GLenum) 120)
+#define GLUT_WINDOW_STEREO		((GLenum) 121)
+#endif
+#if (GLUT_API_VERSION >= 3)
+#define GLUT_WINDOW_CURSOR		((GLenum) 122)
+#endif
+#define GLUT_SCREEN_WIDTH		((GLenum) 200)
+#define GLUT_SCREEN_HEIGHT		((GLenum) 201)
+#define GLUT_SCREEN_WIDTH_MM		((GLenum) 202)
+#define GLUT_SCREEN_HEIGHT_MM		((GLenum) 203)
+#define GLUT_MENU_NUM_ITEMS		((GLenum) 300)
+#define GLUT_DISPLAY_MODE_POSSIBLE	((GLenum) 400)
+#define GLUT_INIT_WINDOW_X		((GLenum) 500)
+#define GLUT_INIT_WINDOW_Y		((GLenum) 501)
+#define GLUT_INIT_WINDOW_WIDTH		((GLenum) 502)
+#define GLUT_INIT_WINDOW_HEIGHT		((GLenum) 503)
+#define GLUT_INIT_DISPLAY_MODE		((GLenum) 504)
+#if (GLUT_API_VERSION >= 2)
+#define GLUT_ELAPSED_TIME		((GLenum) 700)
+#endif
+#if (GLUT_API_VERSION >= 4 || GLUT_XLIB_IMPLEMENTATION >= 13)
+#define GLUT_WINDOW_FORMAT_ID		((GLenum) 123)
+#endif
+
+#if (GLUT_API_VERSION >= 2)
+	/* glutDeviceGet parameters. */
+#define GLUT_HAS_KEYBOARD		((GLenum) 600)
+#define GLUT_HAS_MOUSE			((GLenum) 601)
+#define GLUT_HAS_SPACEBALL		((GLenum) 602)
+#define GLUT_HAS_DIAL_AND_BUTTON_BOX	((GLenum) 603)
+#define GLUT_HAS_TABLET			((GLenum) 604)
+#define GLUT_NUM_MOUSE_BUTTONS		((GLenum) 605)
+#define GLUT_NUM_SPACEBALL_BUTTONS	((GLenum) 606)
+#define GLUT_NUM_BUTTON_BOX_BUTTONS	((GLenum) 607)
+#define GLUT_NUM_DIALS			((GLenum) 608)
+#define GLUT_NUM_TABLET_BUTTONS		((GLenum) 609)
+#endif
+#if (GLUT_API_VERSION >= 4 || GLUT_XLIB_IMPLEMENTATION >= 13)
+#define GLUT_DEVICE_IGNORE_KEY_REPEAT   ((GLenum) 610)
+#define GLUT_DEVICE_KEY_REPEAT          ((GLenum) 611)
+#define GLUT_HAS_JOYSTICK		((GLenum) 612)
+#define GLUT_OWNS_JOYSTICK		((GLenum) 613)
+#define GLUT_JOYSTICK_BUTTONS		((GLenum) 614)
+#define GLUT_JOYSTICK_AXES		((GLenum) 615)
+#define GLUT_JOYSTICK_POLL_RATE		((GLenum) 616)
+#endif
+
+#if (GLUT_API_VERSION >= 3)
+	/* glutLayerGet parameters. */
+#define GLUT_OVERLAY_POSSIBLE           ((GLenum) 800)
+#define GLUT_LAYER_IN_USE		((GLenum) 801)
+#define GLUT_HAS_OVERLAY		((GLenum) 802)
+#define GLUT_TRANSPARENT_INDEX		((GLenum) 803)
+#define GLUT_NORMAL_DAMAGED		((GLenum) 804)
+#define GLUT_OVERLAY_DAMAGED		((GLenum) 805)
+
+#if (GLUT_API_VERSION >= 4 || GLUT_XLIB_IMPLEMENTATION >= 9)
+	/* glutVideoResizeGet parameters. */
+#define GLUT_VIDEO_RESIZE_POSSIBLE	((GLenum) 900)
+#define GLUT_VIDEO_RESIZE_IN_USE	((GLenum) 901)
+#define GLUT_VIDEO_RESIZE_X_DELTA	((GLenum) 902)
+#define GLUT_VIDEO_RESIZE_Y_DELTA	((GLenum) 903)
+#define GLUT_VIDEO_RESIZE_WIDTH_DELTA	((GLenum) 904)
+#define GLUT_VIDEO_RESIZE_HEIGHT_DELTA	((GLenum) 905)
+#define GLUT_VIDEO_RESIZE_X		((GLenum) 906)
+#define GLUT_VIDEO_RESIZE_Y		((GLenum) 907)
+#define GLUT_VIDEO_RESIZE_WIDTH		((GLenum) 908)
+#define GLUT_VIDEO_RESIZE_HEIGHT	((GLenum) 909)
+#endif
+
+	/* glutUseLayer parameters. */
+#define GLUT_NORMAL			((GLenum) 0)
+#define GLUT_OVERLAY			((GLenum) 1)
+
+	/* glutGetModifiers return mask. */
+#define GLUT_ACTIVE_SHIFT               1
+#define GLUT_ACTIVE_CTRL                2
+#define GLUT_ACTIVE_ALT                 4
+
+	/* glutSetCursor parameters. */
+	/* Basic arrows. */
+#define GLUT_CURSOR_RIGHT_ARROW		0
+#define GLUT_CURSOR_LEFT_ARROW		1
+	/* Symbolic cursor shapes. */
+#define GLUT_CURSOR_INFO		2
+#define GLUT_CURSOR_DESTROY		3
+#define GLUT_CURSOR_HELP		4
+#define GLUT_CURSOR_CYCLE		5
+#define GLUT_CURSOR_SPRAY		6
+#define GLUT_CURSOR_WAIT		7
+#define GLUT_CURSOR_TEXT		8
+#define GLUT_CURSOR_CROSSHAIR		9
+	/* Directional cursors. */
+#define GLUT_CURSOR_UP_DOWN		10
+#define GLUT_CURSOR_LEFT_RIGHT		11
+	/* Sizing cursors. */
+#define GLUT_CURSOR_TOP_SIDE		12
+#define GLUT_CURSOR_BOTTOM_SIDE		13
+#define GLUT_CURSOR_LEFT_SIDE		14
+#define GLUT_CURSOR_RIGHT_SIDE		15
+#define GLUT_CURSOR_TOP_LEFT_CORNER	16
+#define GLUT_CURSOR_TOP_RIGHT_CORNER	17
+#define GLUT_CURSOR_BOTTOM_RIGHT_CORNER	18
+#define GLUT_CURSOR_BOTTOM_LEFT_CORNER	19
+	/* Inherit from parent window. */
+#define GLUT_CURSOR_INHERIT		100
+	/* Blank cursor. */
+#define GLUT_CURSOR_NONE		101
+	/* Fullscreen crosshair (if available). */
+#define GLUT_CURSOR_FULL_CROSSHAIR	102
+#endif
+
+	/* GLUT initialization sub-API. */
+	GLUTAPI void APIENTRY glutInit(int* argcp, char** argv);
+#if defined(_WIN32) && !defined(GLUT_DISABLE_ATEXIT_HACK)
+	GLUTAPI void APIENTRY __glutInitWithExit(int* argcp, char** argv, void (__cdecl* exitfunc)(int));
+#ifndef GLUT_BUILDING_LIB
+	static void APIENTRY glutInit_ATEXIT_HACK(int* argcp, char** argv)
+	{
+		__glutInitWithExit(argcp, argv, exit);
+	}
+#define glutInit glutInit_ATEXIT_HACK
+#endif
+#endif
+	GLUTAPI void APIENTRY glutInitDisplayMode(unsigned int mode);
+#if (GLUT_API_VERSION >= 4 || GLUT_XLIB_IMPLEMENTATION >= 9)
+	GLUTAPI void APIENTRY glutInitDisplayString(const char* string);
+#endif
+	GLUTAPI void APIENTRY glutInitWindowPosition(int x, int y);
+	GLUTAPI void APIENTRY glutInitWindowSize(int width, int height);
+	GLUTAPI void APIENTRY glutMainLoop(void);
+
+	/* GLUT window sub-API. */
+	GLUTAPI int APIENTRY glutCreateWindow(const char* title);
+#if defined(_WIN32) && !defined(GLUT_DISABLE_ATEXIT_HACK)
+	GLUTAPI int APIENTRY __glutCreateWindowWithExit(const char* title, void (__cdecl* exitfunc)(int));
+#ifndef GLUT_BUILDING_LIB
+	static int APIENTRY glutCreateWindow_ATEXIT_HACK(const char* title)
+	{
+		return __glutCreateWindowWithExit(title, exit);
+	}
+#define glutCreateWindow glutCreateWindow_ATEXIT_HACK
+#endif
+#endif
+	GLUTAPI int APIENTRY glutCreateSubWindow(int win, int x, int y, int width, int height);
+	GLUTAPI void APIENTRY glutDestroyWindow(int win);
+	GLUTAPI void APIENTRY glutPostRedisplay(void);
+#if (GLUT_API_VERSION >= 4 || GLUT_XLIB_IMPLEMENTATION >= 11)
+	GLUTAPI void APIENTRY glutPostWindowRedisplay(int win);
+#endif
+	GLUTAPI void APIENTRY glutSwapBuffers(void);
+	GLUTAPI int APIENTRY glutGetWindow(void);
+	GLUTAPI void APIENTRY glutSetWindow(int win);
+	GLUTAPI void APIENTRY glutSetWindowTitle(const char* title);
+	GLUTAPI void APIENTRY glutSetIconTitle(const char* title);
+	GLUTAPI void APIENTRY glutPositionWindow(int x, int y);
+	GLUTAPI void APIENTRY glutReshapeWindow(int width, int height);
+	GLUTAPI void APIENTRY glutPopWindow(void);
+	GLUTAPI void APIENTRY glutPushWindow(void);
+	GLUTAPI void APIENTRY glutIconifyWindow(void);
+	GLUTAPI void APIENTRY glutShowWindow(void);
+	GLUTAPI void APIENTRY glutHideWindow(void);
+#if (GLUT_API_VERSION >= 3)
+	GLUTAPI void APIENTRY glutFullScreen(void);
+	GLUTAPI void APIENTRY glutSetCursor(int cursor);
+#if (GLUT_API_VERSION >= 4 || GLUT_XLIB_IMPLEMENTATION >= 9)
+	GLUTAPI void APIENTRY glutWarpPointer(int x, int y);
+#endif
+
+	/* GLUT overlay sub-API. */
+	GLUTAPI void APIENTRY glutEstablishOverlay(void);
+	GLUTAPI void APIENTRY glutRemoveOverlay(void);
+	GLUTAPI void APIENTRY glutUseLayer(GLenum layer);
+	GLUTAPI void APIENTRY glutPostOverlayRedisplay(void);
+#if (GLUT_API_VERSION >= 4 || GLUT_XLIB_IMPLEMENTATION >= 11)
+	GLUTAPI void APIENTRY glutPostWindowOverlayRedisplay(int win);
+#endif
+	GLUTAPI void APIENTRY glutShowOverlay(void);
+	GLUTAPI void APIENTRY glutHideOverlay(void);
+#endif
+
+	/* GLUT menu sub-API. */
+	GLUTAPI int APIENTRY glutCreateMenu(void (GLUTCALLBACK* func)(int));
+#if defined(_WIN32) && !defined(GLUT_DISABLE_ATEXIT_HACK)
+	GLUTAPI int APIENTRY __glutCreateMenuWithExit(void (GLUTCALLBACK* func)(int), void (__cdecl* exitfunc)(int));
+#ifndef GLUT_BUILDING_LIB
+	static int APIENTRY glutCreateMenu_ATEXIT_HACK(void (GLUTCALLBACK* func)(int))
+	{
+		return __glutCreateMenuWithExit(func, exit);
+	}
+#define glutCreateMenu glutCreateMenu_ATEXIT_HACK
+#endif
+#endif
+	GLUTAPI void APIENTRY glutDestroyMenu(int menu);
+	GLUTAPI int APIENTRY glutGetMenu(void);
+	GLUTAPI void APIENTRY glutSetMenu(int menu);
+	GLUTAPI void APIENTRY glutAddMenuEntry(const char* label, int value);
+	GLUTAPI void APIENTRY glutAddSubMenu(const char* label, int submenu);
+	GLUTAPI void APIENTRY glutChangeToMenuEntry(int item, const char* label, int value);
+	GLUTAPI void APIENTRY glutChangeToSubMenu(int item, const char* label, int submenu);
+	GLUTAPI void APIENTRY glutRemoveMenuItem(int item);
+	GLUTAPI void APIENTRY glutAttachMenu(int button);
+	GLUTAPI void APIENTRY glutDetachMenu(int button);
+
+	/* GLUT window callback sub-API. */
+	GLUTAPI void APIENTRY glutDisplayFunc(void (GLUTCALLBACK* func)(void));
+	GLUTAPI void APIENTRY glutReshapeFunc(void (GLUTCALLBACK* func)(int width, int height));
+	GLUTAPI void APIENTRY glutKeyboardFunc(void (GLUTCALLBACK* func)(unsigned char key, int x, int y));
+	GLUTAPI void APIENTRY glutMouseFunc(void (GLUTCALLBACK* func)(int button, int state, int x, int y));
+	GLUTAPI void APIENTRY glutMotionFunc(void (GLUTCALLBACK* func)(int x, int y));
+	GLUTAPI void APIENTRY glutPassiveMotionFunc(void (GLUTCALLBACK* func)(int x, int y));
+	GLUTAPI void APIENTRY glutEntryFunc(void (GLUTCALLBACK* func)(int state));
+	GLUTAPI void APIENTRY glutVisibilityFunc(void (GLUTCALLBACK* func)(int state));
+	GLUTAPI void APIENTRY glutIdleFunc(void (GLUTCALLBACK* func)(void));
+	GLUTAPI void APIENTRY glutTimerFunc(unsigned int millis, void (GLUTCALLBACK* func)(int value), int value);
+	GLUTAPI void APIENTRY glutMenuStateFunc(void (GLUTCALLBACK* func)(int state));
+#if (GLUT_API_VERSION >= 2)
+	GLUTAPI void APIENTRY glutSpecialFunc(void (GLUTCALLBACK* func)(int key, int x, int y));
+	GLUTAPI void APIENTRY glutSpaceballMotionFunc(void (GLUTCALLBACK* func)(int x, int y, int z));
+	GLUTAPI void APIENTRY glutSpaceballRotateFunc(void (GLUTCALLBACK* func)(int x, int y, int z));
+	GLUTAPI void APIENTRY glutSpaceballButtonFunc(void (GLUTCALLBACK* func)(int button, int state));
+	GLUTAPI void APIENTRY glutButtonBoxFunc(void (GLUTCALLBACK* func)(int button, int state));
+	GLUTAPI void APIENTRY glutDialsFunc(void (GLUTCALLBACK* func)(int dial, int value));
+	GLUTAPI void APIENTRY glutTabletMotionFunc(void (GLUTCALLBACK* func)(int x, int y));
+	GLUTAPI void APIENTRY glutTabletButtonFunc(void (GLUTCALLBACK* func)(int button, int state, int x, int y));
+#if (GLUT_API_VERSION >= 3)
+	GLUTAPI void APIENTRY glutMenuStatusFunc(void (GLUTCALLBACK* func)(int status, int x, int y));
+	GLUTAPI void APIENTRY glutOverlayDisplayFunc(void (GLUTCALLBACK* func)(void));
+#if (GLUT_API_VERSION >= 4 || GLUT_XLIB_IMPLEMENTATION >= 9)
+	GLUTAPI void APIENTRY glutWindowStatusFunc(void (GLUTCALLBACK* func)(int state));
+#endif
+#if (GLUT_API_VERSION >= 4 || GLUT_XLIB_IMPLEMENTATION >= 13)
+	GLUTAPI void APIENTRY glutKeyboardUpFunc(void (GLUTCALLBACK* func)(unsigned char key, int x, int y));
+	GLUTAPI void APIENTRY glutSpecialUpFunc(void (GLUTCALLBACK* func)(int key, int x, int y));
+	GLUTAPI void APIENTRY glutJoystickFunc(void (GLUTCALLBACK* func)(unsigned int buttonMask, int x, int y, int z), int pollInterval);
+#endif
+#endif
+#endif
+
+	/* GLUT color index sub-API. */
+	GLUTAPI void APIENTRY glutSetColor(int, GLfloat red, GLfloat green, GLfloat blue);
+	GLUTAPI GLfloat APIENTRY glutGetColor(int ndx, int component);
+	GLUTAPI void APIENTRY glutCopyColormap(int win);
+
+	/* GLUT state retrieval sub-API. */
+	GLUTAPI int APIENTRY glutGet(GLenum type);
+	GLUTAPI int APIENTRY glutDeviceGet(GLenum type);
+#if (GLUT_API_VERSION >= 2)
+	/* GLUT extension support sub-API */
+	GLUTAPI int APIENTRY glutExtensionSupported(const char* name);
+#endif
+#if (GLUT_API_VERSION >= 3)
+	GLUTAPI int APIENTRY glutGetModifiers(void);
+	GLUTAPI int APIENTRY glutLayerGet(GLenum type);
+#endif
+
+	/* GLUT font sub-API */
+	GLUTAPI void APIENTRY glutBitmapCharacter(void* font, int character);
+	GLUTAPI int APIENTRY glutBitmapWidth(void* font, int character);
+	GLUTAPI void APIENTRY glutStrokeCharacter(void* font, int character);
+	GLUTAPI int APIENTRY glutStrokeWidth(void* font, int character);
+#if (GLUT_API_VERSION >= 4 || GLUT_XLIB_IMPLEMENTATION >= 9)
+	GLUTAPI int APIENTRY glutBitmapLength(void* font, const unsigned char* string);
+	GLUTAPI int APIENTRY glutStrokeLength(void* font, const unsigned char* string);
+#endif
+
+	/* GLUT pre-built models sub-API */
+	GLUTAPI void APIENTRY glutWireSphere(GLdouble radius, GLint slices, GLint stacks);
+	GLUTAPI void APIENTRY glutSolidSphere(GLdouble radius, GLint slices, GLint stacks);
+	GLUTAPI void APIENTRY glutWireCone(GLdouble base, GLdouble height, GLint slices, GLint stacks);
+	GLUTAPI void APIENTRY glutSolidCone(GLdouble base, GLdouble height, GLint slices, GLint stacks);
+	GLUTAPI void APIENTRY glutWireCube(GLdouble size);
+	GLUTAPI void APIENTRY glutSolidCube(GLdouble size);
+	GLUTAPI void APIENTRY glutWireTorus(GLdouble innerRadius, GLdouble outerRadius, GLint sides, GLint rings);
+	GLUTAPI void APIENTRY glutSolidTorus(GLdouble innerRadius, GLdouble outerRadius, GLint sides, GLint rings);
+	GLUTAPI void APIENTRY glutWireDodecahedron(void);
+	GLUTAPI void APIENTRY glutSolidDodecahedron(void);
+	GLUTAPI void APIENTRY glutWireTeapot(GLdouble size);
+	GLUTAPI void APIENTRY glutSolidTeapot(GLdouble size);
+	GLUTAPI void APIENTRY glutWireOctahedron(void);
+	GLUTAPI void APIENTRY glutSolidOctahedron(void);
+	GLUTAPI void APIENTRY glutWireTetrahedron(void);
+	GLUTAPI void APIENTRY glutSolidTetrahedron(void);
+	GLUTAPI void APIENTRY glutWireIcosahedron(void);
+	GLUTAPI void APIENTRY glutSolidIcosahedron(void);
+
+#if (GLUT_API_VERSION >= 4 || GLUT_XLIB_IMPLEMENTATION >= 9)
+	/* GLUT video resize sub-API. */
+	GLUTAPI int APIENTRY glutVideoResizeGet(GLenum param);
+	GLUTAPI void APIENTRY glutSetupVideoResizing(void);
+	GLUTAPI void APIENTRY glutStopVideoResizing(void);
+	GLUTAPI void APIENTRY glutVideoResize(int x, int y, int width, int height);
+	GLUTAPI void APIENTRY glutVideoPan(int x, int y, int width, int height);
+
+	/* GLUT debugging sub-API. */
+	GLUTAPI void APIENTRY glutReportErrors(void);
+#endif
+
+#if (GLUT_API_VERSION >= 4 || GLUT_XLIB_IMPLEMENTATION >= 13)
+	/* GLUT device control sub-API. */
+	/* glutSetKeyRepeat modes. */
+#define GLUT_KEY_REPEAT_OFF		0
+#define GLUT_KEY_REPEAT_ON		1
+#define GLUT_KEY_REPEAT_DEFAULT		2
+
+	/* Joystick button masks. */
+#define GLUT_JOYSTICK_BUTTON_A		1
+#define GLUT_JOYSTICK_BUTTON_B		2
+#define GLUT_JOYSTICK_BUTTON_C		4
+#define GLUT_JOYSTICK_BUTTON_D		8
+
+	GLUTAPI void APIENTRY glutIgnoreKeyRepeat(int ignore);
+	GLUTAPI void APIENTRY glutSetKeyRepeat(int repeatMode);
+	GLUTAPI void APIENTRY glutForceJoystickFunc(void);
+
+	/* GLUT game mode sub-API. */
+	/* glutGameModeGet. */
+#define GLUT_GAME_MODE_ACTIVE           ((GLenum) 0)
+#define GLUT_GAME_MODE_POSSIBLE         ((GLenum) 1)
+#define GLUT_GAME_MODE_WIDTH            ((GLenum) 2)
+#define GLUT_GAME_MODE_HEIGHT           ((GLenum) 3)
+#define GLUT_GAME_MODE_PIXEL_DEPTH      ((GLenum) 4)
+#define GLUT_GAME_MODE_REFRESH_RATE     ((GLenum) 5)
+#define GLUT_GAME_MODE_DISPLAY_CHANGED  ((GLenum) 6)
+
+	GLUTAPI void APIENTRY glutGameModeString(const char* string);
+	GLUTAPI int APIENTRY glutEnterGameMode(void);
+	GLUTAPI void APIENTRY glutLeaveGameMode(void);
+	GLUTAPI int APIENTRY glutGameModeGet(GLenum mode);
+#endif
+
+#ifdef __cplusplus
+}
+
+#endif
+
+#ifdef GLUT_APIENTRY_DEFINED
+# undef GLUT_APIENTRY_DEFINED
+# undef APIENTRY
+#endif
+
+#ifdef GLUT_WINGDIAPI_DEFINED
+# undef GLUT_WINGDIAPI_DEFINED
+# undef WINGDIAPI
+#endif
+
+#ifdef GLUT_DEFINED___CDECL
+# undef GLUT_DEFINED___CDECL
+# undef __cdecl
+#endif
+
+#ifdef GLUT_DEFINED__CRTIMP
+# undef GLUT_DEFINED__CRTIMP
+# undef _CRTIMP
+#endif
+
+#endif                  /* __glut_h__ */
diff --git a/APEX_1.4/shared/external/include/MaterialLibrary.h b/APEX_1.4/shared/external/include/MaterialLibrary.h
new file mode 100644
index 00000000..846057b5
--- /dev/null
+++ b/APEX_1.4/shared/external/include/MaterialLibrary.h
@@ -0,0 +1,131 @@
+/*
+ * Copyright (c) 2008-2015, NVIDIA CORPORATION.  All rights reserved.
+ *
+ * NVIDIA CORPORATION and its licensors retain all intellectual property
+ * and proprietary rights in and to this software, related documentation
+ * and any modifications thereto.  Any use, reproduction, disclosure or
+ * distribution of this software and related documentation without an express
+ * license agreement from NVIDIA CORPORATION is strictly prohibited.
+ */
+
+#ifndef MATERIAL_LIBRARY_H
+#define MATERIAL_LIBRARY_H
+
+#include "ApexUsingNamespace.h"
+#include "PxVec3.h"
+
+/**
+	Texture map types.  Currently the MaterialLibrary interface only supports one map of each type.
+*/
+enum TextureMapType
+{
+	DIFFUSE_MAP = 0,
+	BUMP_MAP,
+	NORMAL_MAP,
+
+	TEXTURE_MAP_TYPE_COUNT
+};
+
+
+/**
+	Texture pixel format types, a supported by the Destruction tool's bmp, dds, and tga texture loaders.
+*/
+enum PixelFormat
+{
+	PIXEL_FORMAT_UNKNOWN,
+
+	PIXEL_FORMAT_RGB,
+	PIXEL_FORMAT_BGR_EXT,
+	PIXEL_FORMAT_BGRA_EXT,
+	PIXEL_FORMAT_COMPRESSED_RGBA_S3TC_DXT1_EXT,
+	PIXEL_FORMAT_COMPRESSED_RGBA_S3TC_DXT3_EXT,
+	PIXEL_FORMAT_COMPRESSED_RGBA_S3TC_DXT5_EXT,
+};
+
+
+/**
+	Basic interface to query generic texture map data.
+*/
+class TextureMap
+{
+public:
+
+	/** The texture pixel format, supported by the Destruction tool's texture loaders. */
+	virtual PixelFormat	getPixelFormat() const = 0;
+
+	/** The horizontal texture map size, in pixels. */
+	virtual uint32_t				getWidth() const = 0;
+
+	/** The vertical texture map size, in pixels. */
+	virtual uint32_t				getHeight() const = 0;
+
+	/** The number of color/alpha/etc. channels. */
+	virtual uint32_t				getComponentCount() const = 0;
+
+	/** The size, in bytes, of the pixel buffer. */
+	virtual uint32_t				getPixelBufferSize() const = 0;
+
+	/** The beginning address of the pixel buffer. */
+	virtual uint8_t*				getPixels() const = 0;
+};
+
+
+/**
+	Basic interface to query generic render material data.
+*/
+class Material
+{
+public:
+
+	/** The material's name, used by the named resource provider. */
+	virtual const char*			getName() const = 0;
+
+	/** Access to the material's texture maps, indexed by TextureMapType. */
+	virtual TextureMap*	getTextureMap(TextureMapType type) const = 0;
+
+	/** The ambient lighting color of the material. */
+	virtual const physx::PxVec3&		getAmbient() const = 0;
+
+	/** The diffuse lighting color of the material. */
+	virtual const physx::PxVec3&		getDiffuse() const = 0;
+
+	/** The specular lighting color of the material. */
+	virtual const physx::PxVec3&		getSpecular() const = 0;
+
+	/** The opacity of the material. */
+	virtual float				getAlpha() const = 0;
+
+	/** The shininess (specular power) of the material. */
+	virtual float				getShininess() const = 0;
+};
+
+
+/**
+	Material library skeleton interface.
+*/
+class MaterialLibrary
+{
+public:
+
+	/** Saves the material to an physx::PxFileBuf. */
+	virtual void			serialize(physx::PxFileBuf& stream) const = 0;
+
+	/** Loads material from an physx::PxFileBuf. */
+	virtual void			deserialize(physx::PxFileBuf& stream) = 0;
+
+	/**
+		Query a material by name.
+		If the material already exists, it is returned and 'created' is set to false.
+		If the material did not exist before, it is created, returned, and 'created' is set to true.
+	*/
+	virtual Material*	getMaterial(const char* materialName, bool& created) = 0;
+
+	/**
+		Remove and delete named material.
+		Returns true if the material was found, false if it was not.
+	*/
+	virtual bool			deleteMaterial(const char* materialName) = 0;
+};
+
+
+#endif // #ifndef MATERIAL_LIBRARY_H
diff --git a/APEX_1.4/shared/external/include/MaterialList.h b/APEX_1.4/shared/external/include/MaterialList.h
new file mode 100644
index 00000000..bd46a8e1
--- /dev/null
+++ b/APEX_1.4/shared/external/include/MaterialList.h
@@ -0,0 +1,75 @@
+/*
+ * Copyright (c) 2008-2015, NVIDIA CORPORATION.  All rights reserved.
+ *
+ * NVIDIA CORPORATION and its licensors retain all intellectual property
+ * and proprietary rights in and to this software, related documentation
+ * and any modifications thereto.  Any use, reproduction, disclosure or
+ * distribution of this software and related documentation without an express
+ * license agreement from NVIDIA CORPORATION is strictly prohibited.
+ */
+
+
+#ifndef MATERIAL_LIST_H
+#define MATERIAL_LIST_H
+
+#include <map>
+#include <string>
+#include <vector>
+
+namespace Samples
+{
+
+class MaterialList
+{
+public:
+	MaterialList();
+	~MaterialList();
+
+	void clear();
+	void addPath(const char* path);
+
+	struct MaterialInfo
+	{
+		MaterialInfo();
+		bool isLit;
+		bool vshaderStatic;
+		bool vshader1bone;
+		bool vshader4bones;
+		unsigned int fromPath;
+
+		std::string diffuseTexture;
+		std::string normalTexture;
+	};
+
+	struct TextureInfo
+	{
+		TextureInfo();
+		unsigned int fromPath;
+	};
+
+	const MaterialInfo* containsMaterial(const char* materialName) const;
+	const char* findClosest(const char* materialName) const;
+
+	const TextureInfo* containsTexture(const char* textureName) const;
+
+	void getFirstMaterial(std::string& name, MaterialInfo& info);
+	bool getNextMaterial(std::string& name, MaterialInfo& info);
+
+private:
+	unsigned int addMaterial(const char* directory, const char* prefix, const char* materialName);
+	unsigned int addTexture(const char* directory, const char* prefix, const char* textureName);
+
+	std::vector<std::string> mPaths;
+
+	typedef std::map<std::string, MaterialInfo> tMaterialNames;
+	tMaterialNames mMaterialNames;
+	tMaterialNames::const_iterator mMaterialIterator;
+
+	typedef std::map<std::string, TextureInfo> tTextureNames;
+	tTextureNames mTextureNames;
+};
+
+} // namespace Samples
+
+
+#endif // MATERIAL_LIST_H
diff --git a/APEX_1.4/shared/external/include/MemTracker.h b/APEX_1.4/shared/external/include/MemTracker.h
new file mode 100644
index 00000000..83a817c3
--- /dev/null
+++ b/APEX_1.4/shared/external/include/MemTracker.h
@@ -0,0 +1,125 @@
+/*
+ * Copyright (c) 2008-2015, NVIDIA CORPORATION.  All rights reserved.
+ *
+ * NVIDIA CORPORATION and its licensors retain all intellectual property
+ * and proprietary rights in and to this software, related documentation
+ * and any modifications thereto.  Any use, reproduction, disclosure or
+ * distribution of this software and related documentation without an express
+ * license agreement from NVIDIA CORPORATION is strictly prohibited.
+ */
+
+
+#ifndef MEM_TRACKER_H
+
+#define MEM_TRACKER_H
+
+#include "PxSimpleTypes.h"
+#include "ApexUsingNamespace.h"
+
+#if PX_WINDOWS_FAMILY // only compile this source code for windows!!
+
+namespace MEM_TRACKER
+{
+
+/**
+\brief The layout format for the memory report.
+*/
+enum MemoryReportFormat
+{
+	MRF_SIMPLE_HTML,       // just a very simple HTML document containing the tables.
+	MRF_CSV,               // Saves the Tables out as comma seperated value text
+	MRF_TEXT,              // Saves the tables out in human readable text format.
+	MRF_TEXT_EXTENDED,     // Saves the tables out in human readable text format, but uses the MS-DOS style extended ASCII character set for the borders.
+};
+
+/**
+\brief This enumeration indicates the type of memory allocation that is being performed.
+*/
+enum MemoryType
+{
+	MT_NEW,						// Captured new operator
+	MT_NEW_ARRAY,				// Captured new array operator
+	MT_MALLOC,					// Standard heap allocation
+	MT_FREE,					// Standard heap free
+	MT_DELETE,					// Captured delete operator
+	MT_DELETE_ARRAY,			// Captured array delete
+	MT_GLOBAL_NEW,				// Allocation via Global new
+	MT_GLOBAL_NEW_ARRAY,		// Allocation via global new array
+	MT_GLOBAL_DELETE,			// Deallocation via global delete
+	MT_GLOBAL_DELETE_ARRAY,		// Deallocation via global delete array
+};
+
+/**
+\brief This data structure is used to return the current state of a particular block of allocated memory.
+*/
+struct TrackInfo
+{
+	const void		*mMemory;		// Address of memory
+	MemoryType		 mType;			// Type of allocation
+	size_t			mSize;			// Size of the memory allocation
+	const char		*mContext;		// The context of the memory allocation.
+	const char		*mClassName;	// The class or type name of this allocation.
+	const char		*mFileName;		// Source code file name where this allocation occured
+	uint32_t	 mLineNo;		// Source code line number where this allocation occured
+	size_t			mAllocCount; 	// Indicates which time this allocation occured at this particular source file and line number.
+};
+
+
+class MemTracker
+{
+public:
+
+  virtual void trackAlloc(size_t threadId,
+                          void *mem,
+                          size_t size,
+                          MemoryType type,
+                          const char *context,
+                          const char *className,
+                          const char *fileName,
+                          uint32_t lineno) = 0;
+
+  virtual void trackRealloc(size_t threadId,
+	                          void *oldMem,
+ 	                          void *newMem,
+	                          size_t newSize,
+	                          const char *context,
+	                          const char *className,
+	                          const char *fileName,
+	                          uint32_t lineno) = 0;
+
+  virtual void trackFree(size_t threadId,
+                        void *mem,
+                        MemoryType type,
+                        const char *context,
+                        const char *fileName,uint32_t lineno) = 0;
+
+  virtual const char * trackValidateFree(size_t threadId,
+	  void *mem,
+	  MemoryType type,
+	  const char *context,
+	  const char *fileName,uint32_t lineno) = 0;
+
+
+   virtual void trackFrame(void) = 0;
+
+
+   virtual bool trackInfo(const void *mem,TrackInfo &info)  = 0;
+
+
+   virtual void *generateReport(MemoryReportFormat format,const char *fname,uint32_t &saveLen,bool reportAllLeaks) = 0;
+   virtual void releaseReportMemory(void *mem) = 0;
+
+    virtual void usage(void) = 0;
+    virtual size_t detectLeaks(size_t &acount) = 0;
+    virtual void setLogLevel(bool logEveryAllocation,bool logEveyFrame,bool verifySingleThreaded) = 0;
+
+};
+
+MemTracker *createMemTracker(void);
+void        releaseMemTracker(MemTracker *mt);
+
+};
+
+#endif
+
+#endif
diff --git a/APEX_1.4/shared/external/include/MeshPainter.h b/APEX_1.4/shared/external/include/MeshPainter.h
new file mode 100644
index 00000000..ce37f2c7
--- /dev/null
+++ b/APEX_1.4/shared/external/include/MeshPainter.h
@@ -0,0 +1,196 @@
+/*
+ * Copyright (c) 2008-2015, NVIDIA CORPORATION.  All rights reserved.
+ *
+ * NVIDIA CORPORATION and its licensors retain all intellectual property
+ * and proprietary rights in and to this software, related documentation
+ * and any modifications thereto.  Any use, reproduction, disclosure or
+ * distribution of this software and related documentation without an express
+ * license agreement from NVIDIA CORPORATION is strictly prohibited.
+ */
+
+#ifndef MESH_PAINTER_H
+#define MESH_PAINTER_H
+
+#include "ApexUsingNamespace.h"
+#include "PxVec3.h"
+#include "PxBounds3.h"
+
+#if PX_WINDOWS_FAMILY
+
+#include <vector>
+
+namespace nvidia
+{
+namespace apex
+{
+class RenderDebugInterface;
+class ClothingPhysicalMesh;
+}
+}
+
+namespace SharedTools
+{
+struct DistTriPair;
+struct PaintFloatBuffer;
+struct PaintFlagBuffer;
+
+class MeshPainter
+{
+public:
+	MeshPainter();
+	~MeshPainter();
+	void clear();
+
+	void initFrom(const nvidia::apex::ClothingPhysicalMesh* mesh);
+	void initFrom(const physx::PxVec3* vertices, int numVertices, int vertexStride, const uint32_t* indices, int numIndices, int indexStride);
+
+	void clearIndexBufferRange();
+	void addIndexBufferRange(uint32_t start, uint32_t end);
+
+	//void allocateFloatBuffer(uint32_t id);
+
+	void setFloatBuffer(unsigned int id, float* buffer, int stride);
+	void setFlagBuffer(unsigned int id, unsigned int* buffer, int stride);
+
+	void* getFloatBuffer(uint32_t id);
+
+	const std::vector<physx::PxVec3> getVertices() const
+	{
+		return mVertices;
+	}
+	const std::vector<uint32_t>  getIndices() const
+	{
+		return mIndices;
+	}
+
+	void changeRadius(float paintRadius);
+	void setRayAndRadius(const physx::PxVec3& rayOrig, const physx::PxVec3& rayDir, float paintRadius, int brushMode, float falloffExponent, float scaledTargetValue, float targetColor);
+	bool raycastHit()
+	{
+		return !mLastRaycastNormal.isZero();
+	}
+
+	void paintFloat(unsigned int id, float min, float max, float target) const;
+	void paintFlag(unsigned int id, unsigned int flag, bool useAND) const;
+
+	void smoothFloat(uint32_t id, float smoothingFactor, uint32_t numIterations) const;
+	void smoothFloatFast(uint32_t id, uint32_t numIterations) const;
+
+	void drawBrush(nvidia::apex::RenderDebugInterface* batcher) const;
+
+private:
+	PaintFloatBuffer& MeshPainter::getInternalFloatBuffer(unsigned int id);
+	PaintFlagBuffer& MeshPainter::getInternalFlagBuffer(unsigned int id);
+
+	void complete();
+	void computeNormals();
+	void createNeighborInfo();
+	bool rayCast(int& triNr, float& t) const;
+	bool rayTriangleIntersection(const physx::PxVec3& orig, const physx::PxVec3& dir, const physx::PxVec3& a,
+	                             const physx::PxVec3& b, const physx::PxVec3& c, float& t, float& u, float& v) const;
+
+	void computeSiblingInfo(float distanceThreshold);
+
+	physx::PxVec3 getTriangleCenter(int triNr) const;
+	physx::PxVec3 getTriangleNormal(int triNr) const;
+	void collectTriangles() const;
+	bool isValidRange(int vertexNumber) const;
+
+	std::vector<physx::PxVec3> mVertices;
+	std::vector<bool> mVerticesDisabled;
+	std::vector<uint32_t> mIndices;
+	struct IndexBufferRange
+	{
+		bool isOverlapping(const IndexBufferRange& other) const;
+		uint32_t start;
+		uint32_t end;
+	};
+	std::vector<IndexBufferRange> mIndexRanges;
+	std::vector<int> mNeighbors;
+	mutable std::vector<int> mTriMarks;
+	mutable std::vector<DistTriPair> mCollectedTriangles;
+	mutable std::vector<uint32_t> mCollectedVertices;
+	mutable std::vector<float> mCollectedVerticesFloats;
+	mutable std::vector<uint32_t> mSmoothingCollectedIndices;
+
+	std::vector<physx::PxVec3> mNormals;
+	std::vector<physx::PxVec3> mTetraNormals;
+
+	std::vector<PaintFloatBuffer> mFloatBuffers;
+	std::vector<PaintFlagBuffer> mFlagBuffers;
+
+	mutable int mCurrentMark;
+
+	physx::PxVec3 mRayOrig, mRayDir;
+	float mPaintRadius;
+	mutable float mTargetValue;
+	float mScaledTargetValue;
+	int mBrushMode;
+	float mFalloffExponent;
+	float mBrushColor;
+
+	mutable int32_t mLastTriangle;
+	mutable physx::PxVec3 mLastRaycastPos;
+	mutable physx::PxVec3 mLastRaycastNormal;
+
+	std::vector<int32_t> mFirstSibling;
+	std::vector<int32_t> mSiblings;
+};
+
+
+
+struct DistTriPair
+{
+	void set(int triNr, float dist)
+	{
+		this->triNr = triNr;
+		this->dist = dist;
+	}
+	bool operator < (const DistTriPair& f) const
+	{
+		return dist < f.dist;
+	}
+	int triNr;
+	float dist;
+};
+
+
+
+struct PaintFloatBuffer
+{
+	float& operator[](int i)  const
+	{
+		return *(float*)((char*)buffer + i * stride);
+	}
+	float& operator[](unsigned i)  const
+	{
+		return *(float*)((char*)buffer + i * stride);
+	}
+	unsigned int id;
+	void* buffer;
+	int stride;
+	bool allocated;
+};
+
+struct PaintFlagBuffer
+{
+	unsigned int& operator[](int i) const
+	{
+		return *(unsigned int*)((char*)buffer + i * stride);
+	}
+	unsigned int& operator[](unsigned i) const
+	{
+		return *(unsigned int*)((char*)buffer + i * stride);
+	}
+
+	unsigned int id;
+	void* buffer;
+	int stride;
+};
+
+} // namespace SharedTools
+
+
+#endif // PX_WINDOWS_FAMILY
+
+#endif
diff --git a/APEX_1.4/shared/external/include/MultiClientRenderResourceManager.h b/APEX_1.4/shared/external/include/MultiClientRenderResourceManager.h
new file mode 100644
index 00000000..0f40ea84
--- /dev/null
+++ b/APEX_1.4/shared/external/include/MultiClientRenderResourceManager.h
@@ -0,0 +1,90 @@
+/*
+ * Copyright (c) 2008-2015, NVIDIA CORPORATION.  All rights reserved.
+ *
+ * NVIDIA CORPORATION and its licensors retain all intellectual property
+ * and proprietary rights in and to this software, related documentation
+ * and any modifications thereto.  Any use, reproduction, disclosure or
+ * distribution of this software and related documentation without an express
+ * license agreement from NVIDIA CORPORATION is strictly prohibited.
+ */
+
+
+#ifndef MULTI_CLIENT_RENDER_RESOURCE_MANAGER_H
+#define MULTI_CLIENT_RENDER_RESOURCE_MANAGER_H
+
+
+#include "UserRenderResourceManager.h"
+#include "UserRenderer.h"
+
+#include <vector>
+
+
+class MultiClientRenderResourceManager : public nvidia::apex::UserRenderResourceManager
+{
+public:
+
+	MultiClientRenderResourceManager();
+	~MultiClientRenderResourceManager();
+
+	void addChild(nvidia::apex::UserRenderResourceManager* rrm, bool destroyAutomatic);
+
+
+	virtual nvidia::apex::UserRenderVertexBuffer*   createVertexBuffer(const nvidia::apex::UserRenderVertexBufferDesc& desc);
+	virtual void                                     releaseVertexBuffer(nvidia::apex::UserRenderVertexBuffer& buffer);
+
+	virtual nvidia::apex::UserRenderIndexBuffer*    createIndexBuffer(const nvidia::apex::UserRenderIndexBufferDesc& desc);
+	virtual void                                     releaseIndexBuffer(nvidia::apex::UserRenderIndexBuffer& buffer);
+
+	virtual nvidia::apex::UserRenderBoneBuffer*     createBoneBuffer(const nvidia::apex::UserRenderBoneBufferDesc& desc);
+	virtual void                                     releaseBoneBuffer(nvidia::apex::UserRenderBoneBuffer& buffer);
+
+	virtual nvidia::apex::UserRenderInstanceBuffer* createInstanceBuffer(const nvidia::apex::UserRenderInstanceBufferDesc& desc);
+	virtual void                                     releaseInstanceBuffer(nvidia::apex::UserRenderInstanceBuffer& buffer);
+
+	virtual nvidia::apex::UserRenderSpriteBuffer*   createSpriteBuffer(const nvidia::apex::UserRenderSpriteBufferDesc& desc);
+	virtual void                                     releaseSpriteBuffer(nvidia::apex::UserRenderSpriteBuffer& buffer);
+
+	virtual nvidia::apex::UserRenderSurfaceBuffer*	 createSurfaceBuffer( const nvidia::apex::UserRenderSurfaceBufferDesc &desc );
+	virtual void									 releaseSurfaceBuffer( nvidia::apex::UserRenderSurfaceBuffer &buffer );
+
+	virtual nvidia::apex::UserRenderResource*       createResource(const nvidia::apex::UserRenderResourceDesc& desc);
+
+	virtual void                                     releaseResource(nvidia::apex::UserRenderResource& resource);
+
+	virtual uint32_t                             getMaxBonesForMaterial(void* material);
+
+	virtual bool									getSpriteLayoutData(uint32_t spriteCount, 
+																		uint32_t spriteSemanticsBitmap, 
+																		nvidia::apex::UserRenderSpriteBufferDesc* bufferDesc);
+	virtual bool									getInstanceLayoutData(uint32_t particleCount, 
+																		uint32_t particleSemanticsBitmap, 
+																		nvidia::apex::UserRenderInstanceBufferDesc* bufferDesc);
+protected:
+
+	struct Child
+	{
+		Child(nvidia::apex::UserRenderResourceManager* _rrm, bool destroy) : rrm(_rrm), destroyRrm(destroy) {}
+
+		nvidia::apex::UserRenderResourceManager* rrm;
+		bool destroyRrm;
+	};
+
+	std::vector<Child> mChildren;
+};
+
+
+class MultiClientUserRenderer : public nvidia::apex::UserRenderer
+{
+public:
+	MultiClientUserRenderer() {}
+	virtual ~MultiClientUserRenderer() {}
+
+	void addChild(nvidia::apex::UserRenderer* child);
+	virtual void renderResource(const nvidia::apex::RenderContext& context);
+
+protected:
+	std::vector<nvidia::apex::UserRenderer*> mChildren;
+};
+
+
+#endif // MULTI_CLIENT_RENDER_RESOURCE_MANAGER_H
diff --git a/APEX_1.4/shared/external/include/NullRenderer.h b/APEX_1.4/shared/external/include/NullRenderer.h
new file mode 100644
index 00000000..072df8b9
--- /dev/null
+++ b/APEX_1.4/shared/external/include/NullRenderer.h
@@ -0,0 +1,94 @@
+/*
+ * Copyright (c) 2008-2015, NVIDIA CORPORATION.  All rights reserved.
+ *
+ * NVIDIA CORPORATION and its licensors retain all intellectual property
+ * and proprietary rights in and to this software, related documentation
+ * and any modifications thereto.  Any use, reproduction, disclosure or
+ * distribution of this software and related documentation without an express
+ * license agreement from NVIDIA CORPORATION is strictly prohibited.
+ */
+
+#ifndef __NULL_RENDERER_H_
+#define __NULL_RENDERER_H_
+
+#include "Apex.h"
+
+/* This class is intended for use by command line tools that require an
+ * APEX SDK.  Apps which use this renderer should _NOT_ call
+ * updateRenderResources() or dispatchRenderResources().  You _WILL_
+ * crash.
+ */
+
+namespace nvidia
+{
+namespace apex
+{
+
+class NullRenderResourceManager : public UserRenderResourceManager
+{
+public:
+	UserRenderVertexBuffer*	createVertexBuffer(const UserRenderVertexBufferDesc&)
+	{
+		return NULL;
+	}
+	UserRenderIndexBuffer*	createIndexBuffer(const UserRenderIndexBufferDesc&)
+	{
+		return NULL;
+	}
+	UserRenderBoneBuffer*		createBoneBuffer(const UserRenderBoneBufferDesc&)
+	{
+		return NULL;
+	}
+	UserRenderInstanceBuffer*	createInstanceBuffer(const UserRenderInstanceBufferDesc&)
+	{
+		return NULL;
+	}
+	UserRenderSpriteBuffer*   createSpriteBuffer(const UserRenderSpriteBufferDesc&)
+	{
+		return NULL;
+	}
+	UserRenderSurfaceBuffer*   createSurfaceBuffer(const UserRenderSurfaceBufferDesc&)
+	{
+		return NULL;
+	}
+	UserRenderResource*		createResource(const UserRenderResourceDesc&)
+	{
+		return NULL;
+	}
+	void						releaseVertexBuffer(UserRenderVertexBuffer&) {}
+	void						releaseIndexBuffer(UserRenderIndexBuffer&) {}
+	void						releaseBoneBuffer(UserRenderBoneBuffer&) {}
+	void						releaseInstanceBuffer(UserRenderInstanceBuffer&) {}
+	void						releaseSpriteBuffer(UserRenderSpriteBuffer&) {}
+	void						releaseSurfaceBuffer(UserRenderSurfaceBuffer&) {}
+	void						releaseResource(UserRenderResource&) {}
+	uint32_t						getMaxBonesForMaterial(void*)
+	{
+		return 0;
+	}
+
+	/** \brief Get the sprite layout data */
+	virtual bool getSpriteLayoutData(uint32_t spriteCount, uint32_t spriteSemanticsBitmap, nvidia::apex::UserRenderSpriteBufferDesc* textureDescArray) 
+	{
+		PX_UNUSED(spriteCount);
+		PX_UNUSED(spriteSemanticsBitmap);
+		PX_UNUSED(textureDescArray);
+		return false;
+	}
+
+	/** \brief Get the instance layout data */
+	virtual bool getInstanceLayoutData(uint32_t particleCount, uint32_t particleSemanticsBitmap, nvidia::apex::UserRenderInstanceBufferDesc* instanceDescArray) 
+	{
+		PX_UNUSED(particleCount);
+		PX_UNUSED(particleSemanticsBitmap);
+		PX_UNUSED(instanceDescArray);
+		return false;
+	}
+
+
+};
+
+}
+} // end namespace nvidia::apex
+
+#endif
diff --git a/APEX_1.4/shared/external/include/RecordingRenderResourceManager.h b/APEX_1.4/shared/external/include/RecordingRenderResourceManager.h
new file mode 100644
index 00000000..916a5dbf
--- /dev/null
+++ b/APEX_1.4/shared/external/include/RecordingRenderResourceManager.h
@@ -0,0 +1,167 @@
+/*
+ * Copyright (c) 2008-2015, NVIDIA CORPORATION.  All rights reserved.
+ *
+ * NVIDIA CORPORATION and its licensors retain all intellectual property
+ * and proprietary rights in and to this software, related documentation
+ * and any modifications thereto.  Any use, reproduction, disclosure or
+ * distribution of this software and related documentation without an express
+ * license agreement from NVIDIA CORPORATION is strictly prohibited.
+ */
+
+
+#ifndef RECORDING_RENDER_RESOURCE_MANAGER_H
+#define RECORDING_RENDER_RESOURCE_MANAGER_H
+
+#include "UserRenderResourceManager.h"
+#include "UserRenderer.h"
+
+#include <string>
+
+namespace nvidia
+{
+namespace apex
+{
+class RenderVertexBufferData;
+//class RenderBoneBufferData; // not possible, d'oh
+}
+}
+
+#include "UserRenderBoneBuffer.h"
+
+
+class RecordingRenderResourceManager : public nvidia::apex::UserRenderResourceManager
+{
+public:
+
+	class RecorderInterface
+	{
+	public:
+		virtual ~RecorderInterface() {}
+
+		virtual void createVertexBuffer(unsigned int id, const nvidia::apex::UserRenderVertexBufferDesc& desc) = 0;
+		virtual void writeVertexBuffer(unsigned int id, const nvidia::apex::RenderVertexBufferData& data, unsigned int firstVertex, unsigned int numVertices) = 0;
+		virtual void releaseVertexBuffer(unsigned int id) = 0;
+
+		virtual void createIndexBuffer(unsigned int id, const nvidia::apex::UserRenderIndexBufferDesc& desc) = 0;
+		virtual void writeIndexBuffer(unsigned int id, const void* srcData, uint32_t srcStride, unsigned int firstDestElement, unsigned int numElements, nvidia::apex::RenderDataFormat::Enum format) = 0;
+		virtual void releaseIndexBuffer(unsigned int id) = 0;
+
+		virtual void createBoneBuffer(unsigned int id, const nvidia::apex::UserRenderBoneBufferDesc& desc) = 0;
+		virtual void writeBoneBuffer(unsigned int id, const nvidia::apex::RenderBoneBufferData& data, unsigned int firstBone, unsigned int numBones) = 0;
+		virtual void releaseBoneBuffer(unsigned int id) = 0;
+
+		virtual void createResource(unsigned int id, const nvidia::apex::UserRenderResourceDesc& desc) = 0;
+		virtual void renderResource(unsigned int id, const nvidia::apex::UserRenderResourceDesc& desc) = 0;
+		virtual void releaseResource(unsigned int id) = 0;
+
+		virtual void setMaxBonesForMaterial(void* material, unsigned int maxBones) = 0;
+
+	};
+
+	RecordingRenderResourceManager(nvidia::apex::UserRenderResourceManager* child, bool ownsChild, RecorderInterface* recorder);
+	~RecordingRenderResourceManager();
+
+
+	virtual nvidia::apex::UserRenderVertexBuffer*   createVertexBuffer(const nvidia::apex::UserRenderVertexBufferDesc& desc);
+	virtual void                                     releaseVertexBuffer(nvidia::apex::UserRenderVertexBuffer& buffer);
+
+	virtual nvidia::apex::UserRenderIndexBuffer*    createIndexBuffer(const nvidia::apex::UserRenderIndexBufferDesc& desc);
+	virtual void                                     releaseIndexBuffer(nvidia::apex::UserRenderIndexBuffer& buffer);
+
+	virtual nvidia::apex::UserRenderBoneBuffer*     createBoneBuffer(const nvidia::apex::UserRenderBoneBufferDesc& desc);
+	virtual void                                     releaseBoneBuffer(nvidia::apex::UserRenderBoneBuffer& buffer);
+
+	virtual nvidia::apex::UserRenderInstanceBuffer* createInstanceBuffer(const nvidia::apex::UserRenderInstanceBufferDesc& desc);
+	virtual void                                     releaseInstanceBuffer(nvidia::apex::UserRenderInstanceBuffer& buffer);
+
+	virtual nvidia::apex::UserRenderSpriteBuffer*   createSpriteBuffer(const nvidia::apex::UserRenderSpriteBufferDesc& desc);
+	virtual void                                     releaseSpriteBuffer(nvidia::apex::UserRenderSpriteBuffer& buffer);
+
+	virtual nvidia::apex::UserRenderSurfaceBuffer*  createSurfaceBuffer(const nvidia::apex::UserRenderSurfaceBufferDesc& desc);
+	virtual void									 releaseSurfaceBuffer(nvidia::apex::UserRenderSurfaceBuffer& buffer);
+
+	virtual nvidia::apex::UserRenderResource*       createResource(const nvidia::apex::UserRenderResourceDesc& desc);
+
+	virtual void                                     releaseResource(nvidia::apex::UserRenderResource& resource);
+
+	virtual uint32_t                             getMaxBonesForMaterial(void* material);
+
+	/** \brief Get the sprite layout data */
+	virtual bool getSpriteLayoutData(uint32_t spriteCount, uint32_t spriteSemanticsBitmap, nvidia::apex::UserRenderSpriteBufferDesc* textureDescArray)
+	{
+		PX_ALWAYS_ASSERT(); // TODO TODO TODO : This needs to be implemented.
+		PX_UNUSED(spriteCount);
+		PX_UNUSED(spriteSemanticsBitmap);
+		PX_UNUSED(textureDescArray);
+		return false;
+	}
+
+	/** \brief Get the instance layout data */
+	virtual bool getInstanceLayoutData(uint32_t spriteCount, uint32_t spriteSemanticsBitmap, nvidia::apex::UserRenderInstanceBufferDesc* instanceDescArray)
+	{
+		PX_ALWAYS_ASSERT(); // TODO TODO TODO : This needs to be implemented.
+		PX_UNUSED(spriteCount);
+		PX_UNUSED(spriteSemanticsBitmap);
+		PX_UNUSED(instanceDescArray);
+		return false;
+	}
+protected:
+
+	nvidia::apex::UserRenderResourceManager* mChild;
+	bool mOwnsChild;
+
+	RecorderInterface* mRecorder;
+};
+
+
+class RecordingRenderer : public nvidia::apex::UserRenderer
+{
+public:
+	RecordingRenderer(nvidia::apex::UserRenderer* child, RecordingRenderResourceManager::RecorderInterface* recorder);
+	virtual ~RecordingRenderer();
+
+	virtual void renderResource(const nvidia::apex::RenderContext& context);
+
+protected:
+	nvidia::apex::UserRenderer* mChild;
+	RecordingRenderResourceManager::RecorderInterface* mRecorder;
+};
+
+
+class FileRecorder : public RecordingRenderResourceManager::RecorderInterface
+{
+public:
+	FileRecorder(const char* filename);
+	~FileRecorder();
+
+	virtual void createVertexBuffer(unsigned int id, const nvidia::apex::UserRenderVertexBufferDesc& desc);
+	virtual void writeVertexBuffer(unsigned int id, const nvidia::apex::RenderVertexBufferData& data, unsigned int firstVertex, unsigned int numVertices);
+	virtual void releaseVertexBuffer(unsigned int id);
+
+	virtual void createIndexBuffer(unsigned int id, const nvidia::apex::UserRenderIndexBufferDesc& desc);
+	virtual void writeIndexBuffer(unsigned int id, const void* srcData, uint32_t srcStride, unsigned int firstDestElement, unsigned int numElements, nvidia::apex::RenderDataFormat::Enum format);
+	virtual void releaseIndexBuffer(unsigned int id);
+
+	virtual void createBoneBuffer(unsigned int id, const nvidia::apex::UserRenderBoneBufferDesc& desc);
+	virtual void writeBoneBuffer(unsigned int id, const nvidia::apex::RenderBoneBufferData& data, unsigned int firstBone, unsigned int numBones);
+	virtual void releaseBoneBuffer(unsigned int id);
+
+	virtual void createResource(unsigned int id, const nvidia::apex::UserRenderResourceDesc& desc);
+	virtual void renderResource(unsigned int id, const nvidia::apex::UserRenderResourceDesc& desc);
+	virtual void releaseResource(unsigned int id);
+
+	virtual void setMaxBonesForMaterial(void* material, unsigned int maxBones);
+
+protected:
+	void writeElem(const char* name, unsigned int value);
+
+	void writeBufferData(const void* data, unsigned int stride, unsigned int numElements, nvidia::apex::RenderDataFormat::Enum format);
+	void writeBufferDataFloat(const void* data, unsigned int stride, unsigned int numElements, unsigned int numFloatsPerDataSet);
+	void writeBufferDataShort(const void* data, unsigned int stride, unsigned int numElements, unsigned int numFloatsPerDataSet);
+	void writeBufferDataLong(const void* data, unsigned int stride, unsigned int numElements, unsigned int numFloatsPerDataSet);
+
+	FILE* mOutputFile;
+};
+
+
+#endif // RECORDING_RENDER_RESOURCE_MANAGER_H
diff --git a/APEX_1.4/shared/external/include/Releaser.h b/APEX_1.4/shared/external/include/Releaser.h
new file mode 100644
index 00000000..e83c4c20
--- /dev/null
+++ b/APEX_1.4/shared/external/include/Releaser.h
@@ -0,0 +1,97 @@
+/*
+ * Copyright (c) 2008-2015, NVIDIA CORPORATION.  All rights reserved.
+ *
+ * NVIDIA CORPORATION and its licensors retain all intellectual property
+ * and proprietary rights in and to this software, related documentation
+ * and any modifications thereto.  Any use, reproduction, disclosure or
+ * distribution of this software and related documentation without an express
+ * license agreement from NVIDIA CORPORATION is strictly prohibited.
+ */
+
+
+#ifndef RELEASER_H
+#define RELEASER_H
+
+#include <stdio.h>
+
+#include "ApexInterface.h"
+#include "nvparameterized/NvParameterized.h"
+#include "nvparameterized/NvParameterizedTraits.h"
+
+#define RELEASE_AT_EXIT(obj, typeName) Releaser<typeName> obj ## Releaser(obj);
+
+template<typename T>
+class Releaser
+{
+	Releaser(Releaser<T>& rhs);
+	Releaser<T>& operator =(Releaser<T>& rhs);
+
+public:
+	Releaser(T* obj, void* memory = NULL) : mObj(obj), mMemory(memory) 
+	{
+	}
+
+	~Releaser() 
+	{
+		doRelease();
+	}
+
+	void doRelease();
+
+	void reset(T* newObj = NULL, void* newMemory = NULL)
+	{
+		if (newObj != mObj)
+		{
+			doRelease(mObj);
+		}
+		mObj = newObj;
+		mMemory = newMemory;
+	}
+
+private:
+	T* mObj;
+
+	void* mMemory;
+};
+
+template<> PX_INLINE void Releaser<NvParameterized::Interface>::doRelease()
+{
+	if (mObj != NULL)
+	{
+		mObj->destroy();
+	}
+}
+
+template<> PX_INLINE void Releaser<NvParameterized::Traits>::doRelease()
+{
+	if (mMemory != NULL)
+	{
+		mObj->free(mMemory);
+	}
+}
+
+template<> PX_INLINE void Releaser<nvidia::apex::ApexInterface>::doRelease()
+{
+	if (mObj != NULL)
+	{
+		mObj->release();
+	}
+}
+
+template<> PX_INLINE void Releaser<physx::PxFileBuf>::doRelease()
+{
+	if (mObj != NULL)
+	{
+		mObj->release();
+	}
+}
+
+template<> PX_INLINE void Releaser<FILE>::doRelease()
+{
+	if (mObj != NULL)
+	{
+		fclose(mObj);
+	}
+}
+
+#endif	// RESOURCE_MANAGER_H
diff --git a/APEX_1.4/shared/external/include/SampleApexRenderResources.h b/APEX_1.4/shared/external/include/SampleApexRenderResources.h
new file mode 100644
index 00000000..194bb54b
--- /dev/null
+++ b/APEX_1.4/shared/external/include/SampleApexRenderResources.h
@@ -0,0 +1,371 @@
+/*
+ * Copyright (c) 2008-2015, NVIDIA CORPORATION.  All rights reserved.
+ *
+ * NVIDIA CORPORATION and its licensors retain all intellectual property
+ * and proprietary rights in and to this software, related documentation
+ * and any modifications thereto.  Any use, reproduction, disclosure or
+ * distribution of this software and related documentation without an express
+ * license agreement from NVIDIA CORPORATION is strictly prohibited.
+ */
+
+
+// This define will use RendererMaterial instead of SampleMaterialAsset
+#ifndef USE_RENDERER_MATERIAL
+#define USE_RENDERER_MATERIAL 0
+#endif
+
+#include <UserRenderer.h>
+#include <UserRenderResourceManager.h>
+
+#include <RenderContext.h>
+#include <UserRenderBoneBuffer.h>
+#include <UserRenderIndexBuffer.h>
+#include <UserRenderInstanceBuffer.h>
+#include <UserRenderResource.h>
+#include <UserRenderSpriteBuffer.h>
+#include <UserRenderSurfaceBuffer.h>
+#include <UserRenderVertexBuffer.h>
+#include <UserRenderSpriteBufferDesc.h>
+
+#include <RendererInstanceBuffer.h>
+#include <RendererMeshContext.h>
+
+#define	USE_RENDER_SPRITE_BUFFER 1
+#if USE_RENDER_SPRITE_BUFFER
+#include <RendererMaterial.h>
+#endif
+
+#pragma warning(push)
+#pragma warning(disable:4512)
+
+namespace SampleRenderer
+{
+	class Renderer;
+	class RendererVertexBuffer;
+	class RendererIndexBuffer;
+	class RendererMesh;
+	class RendererMeshContext;
+	class RendererTexture;
+}
+
+namespace SampleFramework
+{
+	class SampleMaterialAsset;
+}
+
+using SampleRenderer::RendererVertexBuffer;
+using SampleRenderer::RendererIndexBuffer;
+using SampleRenderer::RendererInstanceBuffer;
+using SampleRenderer::RendererMesh;
+using SampleRenderer::RendererTexture;
+
+
+/*********************************
+* SampleApexRendererVertexBuffer *
+*********************************/
+
+class SampleApexRendererVertexBuffer : public nvidia::apex::UserRenderVertexBuffer
+{
+	friend class SampleApexRendererMesh;
+public:
+	SampleApexRendererVertexBuffer(SampleRenderer::Renderer& renderer, const nvidia::apex::UserRenderVertexBufferDesc& desc);
+	virtual ~SampleApexRendererVertexBuffer(void);
+
+	virtual bool getInteropResourceHandle(CUgraphicsResource& handle);
+
+protected:
+	void fixUVOrigin(void* uvdata, uint32_t stride, uint32_t num);
+	void flipColors(void* uvData, uint32_t stride, uint32_t num);
+
+	virtual void writeBuffer(const nvidia::apex::RenderVertexBufferData& data, uint32_t firstVertex, uint32_t numVerts);
+
+	bool writeBufferFastPath(const nvidia::apex::RenderVertexBufferData& data, uint32_t firstVertex, uint32_t numVerts);
+
+protected:
+	SampleRenderer::Renderer&				m_renderer;
+	SampleRenderer::RendererVertexBuffer*	m_vertexbuffer;
+	nvidia::apex::TextureUVOrigin::Enum	m_uvOrigin;
+};
+
+
+/********************************
+* SampleApexRendererIndexBuffer *
+********************************/
+
+class SampleApexRendererIndexBuffer : public nvidia::apex::UserRenderIndexBuffer
+{
+	friend class SampleApexRendererMesh;
+public:
+	SampleApexRendererIndexBuffer(SampleRenderer::Renderer& renderer, const nvidia::apex::UserRenderIndexBufferDesc& desc);
+	virtual ~SampleApexRendererIndexBuffer(void);
+
+	virtual bool getInteropResourceHandle(CUgraphicsResource& handle);
+
+private:
+	virtual void writeBuffer(const void* srcData, uint32_t srcStride, uint32_t firstDestElement, uint32_t numElements);
+
+private:
+	SampleRenderer::Renderer&					m_renderer;
+	SampleRenderer::RendererIndexBuffer*		m_indexbuffer;
+	nvidia::apex::RenderPrimitiveType::Enum	m_primitives;
+};
+
+
+/********************************
+* SampleApexRendererSurfaceBuffer *
+********************************/
+
+class SampleApexRendererSurfaceBuffer : public nvidia::apex::UserRenderSurfaceBuffer
+{
+public:
+	SampleApexRendererSurfaceBuffer(SampleRenderer::Renderer& renderer, const nvidia::apex::UserRenderSurfaceBufferDesc& desc);
+	virtual ~SampleApexRendererSurfaceBuffer(void);
+
+	virtual bool getInteropResourceHandle(CUgraphicsResource& handle);
+
+private:
+	virtual void writeBuffer(const void* srcData, uint32_t srcPitch, uint32_t srcHeight, uint32_t dstX, uint32_t dstY, uint32_t dstZ, uint32_t width, uint32_t height, uint32_t depth = 1);
+
+private:
+	SampleRenderer::Renderer&					m_renderer;
+	SampleRenderer::RendererTexture*			m_texture;
+};
+
+
+/*******************************
+* SampleApexRendererBoneBuffer *
+*******************************/
+
+class SampleApexRendererBoneBuffer : public nvidia::apex::UserRenderBoneBuffer
+{
+	friend class SampleApexRendererMesh;
+public:
+	SampleApexRendererBoneBuffer(SampleRenderer::Renderer& renderer, const nvidia::apex::UserRenderBoneBufferDesc& desc);
+	virtual ~SampleApexRendererBoneBuffer(void);
+
+	const physx::PxMat44* getBones() const { return m_bones; }
+
+public:
+	virtual void writeBuffer(const nvidia::apex::RenderBoneBufferData& data, uint32_t firstBone, uint32_t numBones);
+
+private:
+	SampleRenderer::Renderer& m_renderer;
+
+	SampleRenderer::RendererTexture* m_boneTexture;	// Vertex texture to hold bone matrices
+	uint32_t m_maxBones;
+	physx::PxMat44* m_bones;
+};
+
+
+/***********************************
+* SampleApexRendererInstanceBuffer *
+***********************************/
+
+class SampleApexRendererInstanceBuffer : public nvidia::apex::UserRenderInstanceBuffer
+{
+	friend class SampleApexRendererMesh;
+public:
+
+	SampleApexRendererInstanceBuffer(SampleRenderer::Renderer& renderer, const nvidia::apex::UserRenderInstanceBufferDesc& desc);
+	virtual ~SampleApexRendererInstanceBuffer(void);
+
+	uint32_t getMaxInstances(void) const
+	{
+		return m_maxInstances;
+	}
+
+public:
+	virtual void writeBuffer(const void* data, uint32_t firstInstance, uint32_t numInstances);
+	bool writeBufferFastPath(const nvidia::apex::RenderInstanceBufferData& data, uint32_t firstInstance, uint32_t numInstances);
+
+	virtual bool getInteropResourceHandle(CUgraphicsResource& handle);
+protected:
+	template<typename ElemType>
+	void internalWriteSemantic(SampleRenderer::RendererInstanceBuffer::Semantic semantic, const void* srcData, uint32_t srcStride, uint32_t firstDestElement, uint32_t numElements)
+	{
+		uint32_t destStride = 0;
+		uint8_t* destData = (uint8_t*)m_instanceBuffer->lockSemantic(semantic, destStride);
+		if (destData)
+		{
+			destData += firstDestElement * destStride;
+			for (uint32_t i = 0; i < numElements; i++)
+			{
+				ElemType* srcElemPtr = (ElemType*)(((uint8_t*)srcData) + srcStride * i);
+
+				*((ElemType*)destData) = *srcElemPtr;
+
+				destData += destStride;
+			}
+			m_instanceBuffer->unlockSemantic(semantic);
+		}
+	}
+private:
+	void internalWriteBuffer(nvidia::apex::RenderInstanceSemantic::Enum semantic, 
+							const void* srcData, uint32_t srcStride,
+							uint32_t firstDestElement, uint32_t numElements);
+
+	uint32_t							m_maxInstances;
+	SampleRenderer::RendererInstanceBuffer*	m_instanceBuffer;
+};
+
+
+#if USE_RENDER_SPRITE_BUFFER
+
+/*********************************
+* SampleApexRendererSpriteBuffer *
+*********************************/
+
+/*
+ *	This class is just a wrapper around the vertex buffer class because there is already
+ *	a point sprite implementation using vertex buffers.  It takes the sprite buffer semantics
+ *  and just converts them to vertex buffer semantics and ignores everything but position and color.
+ *  Well, not really, it takes the lifetime and translates it to color.
+ */
+class SampleApexRendererSpriteBuffer : public nvidia::apex::UserRenderSpriteBuffer
+{
+public:
+	SampleApexRendererSpriteBuffer(SampleRenderer::Renderer& renderer, const nvidia::apex::UserRenderSpriteBufferDesc& desc);
+	virtual ~SampleApexRendererSpriteBuffer(void);
+
+	SampleRenderer::RendererTexture* getTexture(const nvidia::apex::RenderSpriteTextureLayout::Enum e) const;
+	uint32_t getTexturesCount() const;
+
+	virtual bool getInteropResourceHandle(CUgraphicsResource& handle);
+	virtual bool getInteropTextureHandleList(CUgraphicsResource* handleList);
+	virtual void writeBuffer(const void* data, uint32_t firstSprite, uint32_t numSprites);
+	virtual void writeTexture(uint32_t textureId, uint32_t numSprites, const void* srcData, size_t srcSize);
+
+private:
+	void flipColors(void* uvData, uint32_t stride, uint32_t num);
+public:
+	SampleRenderer::Renderer&				m_renderer;
+	SampleRenderer::RendererVertexBuffer*	m_vertexbuffer;
+	SampleRenderer::RendererTexture*		m_textures[nvidia::apex::UserRenderSpriteBufferDesc::MAX_SPRITE_TEXTURES];
+	uint32_t							m_texturesCount;
+	uint32_t							m_textureIndexFromLayoutType[nvidia::apex::RenderSpriteTextureLayout::NUM_LAYOUTS];
+};
+
+#endif /* USE_RENDER_SPRITE_BUFFER */
+
+
+/*************************
+* SampleApexRendererMesh *
+*************************/
+
+/*
+ *	There is some sprite hackery in here now.  Basically, if a sprite buffer is used
+ *	we just treat is as a vertex buffer (because it really is a vertex buffer).
+ */
+class SampleApexRendererMesh : public nvidia::apex::UserRenderResource
+{
+	friend class SampleApexRenderer;
+public:
+	SampleApexRendererMesh(SampleRenderer::Renderer& renderer, const nvidia::apex::UserRenderResourceDesc& desc);
+	virtual ~SampleApexRendererMesh();
+
+	enum BlendType
+	{
+		BLENDING_ENABLED = 0,
+		BLENDING_DISABLED,
+		BLENDING_ANY,
+		BLENDING_DEFAULT = BLENDING_ANY
+	};
+
+public:
+	void setVertexBufferRange(uint32_t firstVertex, uint32_t numVerts);
+	void setIndexBufferRange(uint32_t firstIndex, uint32_t numIndices);
+	void setBoneBufferRange(uint32_t firstBone, uint32_t numBones);
+	void setInstanceBufferRange(uint32_t firstInstance, uint32_t numInstances);
+
+#if USE_RENDER_SPRITE_BUFFER
+	void setSpriteBufferRange(uint32_t firstSprite, uint32_t numSprites)
+	{
+		setVertexBufferRange(firstSprite, numSprites);
+	}
+#endif
+
+#if !USE_RENDERER_MATERIAL
+	static void pickMaterial(SampleRenderer::RendererMeshContext& context, bool hasBones, SampleFramework::SampleMaterialAsset& material, BlendType hasBlending = BLENDING_DEFAULT);
+#endif
+
+	virtual void setMaterial(void* material) { setMaterial(material, BLENDING_DEFAULT); }
+	void setMaterial(void* material, BlendType hasBlending);
+	void setScreenSpace(bool ss);
+
+	uint32_t getNbVertexBuffers() const
+	{
+		return m_numVertexBuffers;
+	}
+
+	nvidia::apex::UserRenderVertexBuffer* getVertexBuffer(uint32_t index) const
+	{
+		nvidia::apex::UserRenderVertexBuffer* buffer = 0;
+		PX_ASSERT(index < m_numVertexBuffers);
+		if (index < m_numVertexBuffers)
+		{
+			buffer = m_vertexBuffers[index];
+		}
+		return buffer;
+	}
+
+	nvidia::apex::UserRenderIndexBuffer* getIndexBuffer() const
+	{
+		return m_indexBuffer;
+	}
+
+	nvidia::apex::UserRenderBoneBuffer* getBoneBuffer()	const
+	{
+		return m_boneBuffer;
+	}
+
+	nvidia::apex::UserRenderInstanceBuffer* getInstanceBuffer()	const
+	{
+		return m_instanceBuffer;
+	}
+
+#if USE_RENDER_SPRITE_BUFFER
+	nvidia::apex::UserRenderSpriteBuffer* getSpriteBuffer()	const
+	{
+		return m_spriteBuffer;
+	}
+#endif
+
+protected:
+	void render(const nvidia::apex::RenderContext& context, bool forceWireframe = false, SampleFramework::SampleMaterialAsset* overrideMaterial = NULL);
+
+protected:
+	SampleRenderer::Renderer&				m_renderer;
+
+#if USE_RENDER_SPRITE_BUFFER
+	SampleApexRendererSpriteBuffer*			m_spriteBuffer;
+
+	// currently this renderer's sprite shaders take 5 variables:
+	// particleSize 
+	// windowWidth
+	// positionTexture
+	// colorTexture
+	// transformTexture
+	// vertexTextureWidth
+	// vertexTextureHeight
+	const SampleRenderer::RendererMaterial::Variable*  m_spriteShaderVariables[7];
+#endif
+
+	SampleApexRendererVertexBuffer**		m_vertexBuffers;
+	uint32_t							m_numVertexBuffers;
+
+	SampleApexRendererIndexBuffer*			m_indexBuffer;
+
+	SampleApexRendererBoneBuffer*			m_boneBuffer;
+	uint32_t							m_firstBone;
+	uint32_t							m_numBones;
+
+	SampleApexRendererInstanceBuffer*		m_instanceBuffer;
+
+	SampleRenderer::RendererMesh*			m_mesh;
+	SampleRenderer::RendererMeshContext		m_meshContext;
+	physx::PxMat44							m_meshTransform;
+	nvidia::apex::RenderCullMode::Enum		m_cullMode;
+};
+
+#pragma warning(pop)
+
diff --git a/APEX_1.4/shared/external/include/SampleApexRenderer.h b/APEX_1.4/shared/external/include/SampleApexRenderer.h
new file mode 100644
index 00000000..1e043de9
--- /dev/null
+++ b/APEX_1.4/shared/external/include/SampleApexRenderer.h
@@ -0,0 +1,106 @@
+/*
+ * Copyright (c) 2008-2015, NVIDIA CORPORATION.  All rights reserved.
+ *
+ * NVIDIA CORPORATION and its licensors retain all intellectual property
+ * and proprietary rights in and to this software, related documentation
+ * and any modifications thereto.  Any use, reproduction, disclosure or
+ * distribution of this software and related documentation without an express
+ * license agreement from NVIDIA CORPORATION is strictly prohibited.
+ */
+
+#ifndef SAMPLE_APEX_RENDERER_H
+#define SAMPLE_APEX_RENDERER_H
+
+#include <UserRenderer.h>
+#include <UserRenderResourceManager.h>
+
+
+#pragma warning(push)
+#pragma warning(disable:4512)
+
+class UserRenderSpriteTextureDesc;
+
+namespace SampleRenderer
+{
+class Renderer;
+}
+
+namespace SampleFramework
+{
+class SampleMaterialAsset;
+}
+
+
+class SampleApexRenderResourceManager : public nvidia::apex::UserRenderResourceManager
+{
+public:
+	/* We either store particle position/color/transform in the texture 
+	   and fetch it in the vertex shader OR we store them in the VBO */
+	enum ParticleRenderingMechanism {
+		VERTEX_TEXTURE_FETCH,
+		VERTEX_BUFFER_OBJECT
+	};
+
+	SampleApexRenderResourceManager(SampleRenderer::Renderer& renderer);
+	virtual								~SampleApexRenderResourceManager(void);
+
+public:
+	virtual nvidia::apex::UserRenderVertexBuffer*		createVertexBuffer(const nvidia::apex::UserRenderVertexBufferDesc& desc);
+	virtual void										releaseVertexBuffer(nvidia::apex::UserRenderVertexBuffer& buffer);
+
+	virtual nvidia::apex::UserRenderIndexBuffer*		createIndexBuffer(const nvidia::apex::UserRenderIndexBufferDesc& desc);
+	virtual void										releaseIndexBuffer(nvidia::apex::UserRenderIndexBuffer& buffer);
+
+	virtual nvidia::apex::UserRenderSurfaceBuffer*		createSurfaceBuffer(const nvidia::apex::UserRenderSurfaceBufferDesc& desc);
+	virtual void										releaseSurfaceBuffer(nvidia::apex::UserRenderSurfaceBuffer& buffer);
+
+	virtual nvidia::apex::UserRenderBoneBuffer*		createBoneBuffer(const nvidia::apex::UserRenderBoneBufferDesc& desc);
+	virtual void										releaseBoneBuffer(nvidia::apex::UserRenderBoneBuffer& buffer);
+
+	virtual nvidia::apex::UserRenderInstanceBuffer*	createInstanceBuffer(const nvidia::apex::UserRenderInstanceBufferDesc& desc);
+	virtual void										releaseInstanceBuffer(nvidia::apex::UserRenderInstanceBuffer& buffer);
+
+	virtual nvidia::apex::UserRenderSpriteBuffer*		createSpriteBuffer(const nvidia::apex::UserRenderSpriteBufferDesc& desc);
+	virtual void										releaseSpriteBuffer(nvidia::apex::UserRenderSpriteBuffer& buffer);
+
+	virtual nvidia::apex::UserRenderResource*			createResource(const nvidia::apex::UserRenderResourceDesc& desc);
+	virtual void										releaseResource(nvidia::apex::UserRenderResource& resource);
+
+	virtual uint32_t								getMaxBonesForMaterial(void* material);
+
+	virtual bool										getSpriteLayoutData(uint32_t spriteCount, 
+																			uint32_t spriteSemanticsBitmap, 
+																			nvidia::apex::UserRenderSpriteBufferDesc* vertexDescArray);
+
+	virtual bool										getInstanceLayoutData(uint32_t spriteCount, 
+																				uint32_t particleSemanticsBitmap, 
+																				nvidia::apex::UserRenderInstanceBufferDesc* instanceDescArray);
+
+	// change the material of a render resource
+	void												setMaterial(nvidia::apex::UserRenderResource& resource, void* material);
+
+	void												setParticleRenderingMechanism(ParticleRenderingMechanism m) { m_particleRenderingMechanism = m;	}
+protected:
+	SampleRenderer::Renderer&	m_renderer;
+	ParticleRenderingMechanism  m_particleRenderingMechanism;
+	uint32_t				m_numVertexBuffers;
+	uint32_t				m_numIndexBuffers;
+	uint32_t				m_numSurfaceBuffers; //?
+	uint32_t				m_numBoneBuffers;
+	uint32_t				m_numInstanceBuffers;
+	uint32_t				m_numResources;
+};
+
+class SampleApexRenderer : public nvidia::apex::UserRenderer
+{
+public:
+	SampleApexRenderer() : mForceWireframe(false), mOverrideMaterial(NULL) {}
+	virtual void renderResource(const nvidia::apex::RenderContext& context);
+
+	bool mForceWireframe;
+	SampleFramework::SampleMaterialAsset* mOverrideMaterial;
+};
+
+#pragma warning(pop)
+
+#endif
diff --git a/APEX_1.4/shared/external/include/SampleApexResourceCallback.h b/APEX_1.4/shared/external/include/SampleApexResourceCallback.h
new file mode 100644
index 00000000..62690452
--- /dev/null
+++ b/APEX_1.4/shared/external/include/SampleApexResourceCallback.h
@@ -0,0 +1,120 @@
+/*
+ * Copyright (c) 2008-2015, NVIDIA CORPORATION.  All rights reserved.
+ *
+ * NVIDIA CORPORATION and its licensors retain all intellectual property
+ * and proprietary rights in and to this software, related documentation
+ * and any modifications thereto.  Any use, reproduction, disclosure or
+ * distribution of this software and related documentation without an express
+ * license agreement from NVIDIA CORPORATION is strictly prohibited.
+ */
+
+#ifndef SAMPLE_APEX_RESOURCE_CALLBACK_H
+#define SAMPLE_APEX_RESOURCE_CALLBACK_H
+
+#include <ApexDefs.h>
+#include <ApexSDK.h>
+#include <PxFiltering.h>
+#include <ResourceCallback.h>
+#include <PxFileBuf.h>
+#include "Find.h"
+#include <SampleAsset.h>
+#include <vector>
+
+#pragma warning(push)
+#pragma warning(disable:4512)
+
+class FilterBits; // forward reference the filter bits class
+
+namespace nvidia
+{
+namespace apex
+{
+class ApexSDK;
+#if APEX_USE_PARTICLES
+class ModuleParticles;
+#endif
+}
+}
+
+namespace SampleRenderer
+{
+class Renderer;
+}
+
+namespace SampleFramework
+{
+class SampleAssetManager;
+}
+
+// TODO: DISABLE ME!!!
+#define WORK_AROUND_BROKEN_ASSET_PATHS 1
+
+enum SampleAssetFileType
+{
+	XML_ASSET,
+	BIN_ASSET,
+	ANY_ASSET,
+};
+
+class SampleApexResourceCallback : public nvidia::apex::ResourceCallback
+{
+public:
+	SampleApexResourceCallback(SampleRenderer::Renderer& renderer, SampleFramework::SampleAssetManager& assetManager);
+	virtual				   ~SampleApexResourceCallback(void);
+
+	void					addResourceSearchPath(const char* path);
+	void					removeResourceSearchPath(const char* path);
+	void					clearResourceSearchPaths();
+
+	void					registerSimulationFilterData(const char* name, const physx::PxFilterData& simulationFilterData);
+	void					registerPhysicalMaterial(const char* name, physx::PxMaterialTableIndex physicalMaterial);
+
+	void					registerGroupsMask64(const char* name, nvidia::apex::GroupsMask64& groupsMask);
+
+	void					setApexSupport(nvidia::apex::ApexSDK& apexSDK);
+
+	physx::PxFileBuf*   	findApexAsset(const char* assetName);
+	void					findFiles(const char* dir, nvidia::apex::FileHandler& handler);
+
+	void					setAssetPreference(SampleAssetFileType pref)
+	{
+		m_assetPreference = pref;
+	}
+
+	static bool				xmlFileExtension(const char* assetName);
+	static const char*		getFileExtension(const char* assetName);
+
+private:
+	SampleFramework::SampleAsset*	findSampleAsset(const char* assetName, SampleFramework::SampleAsset::Type type);
+
+#if WORK_AROUND_BROKEN_ASSET_PATHS
+	const char*				mapHackyPath(const char* path);
+#endif
+
+public:
+	virtual void*			requestResource(const char* nameSpace, const char* name);
+	virtual void			releaseResource(const char* nameSpace, const char* name, void* resource);
+
+	bool					doesFileExist(const char* filename, const char* ext);
+	bool					doesFileExist(const char* filename);
+	bool					isFileReadable(const char* fullPath);
+
+protected:
+	SampleRenderer::Renderer&				m_renderer;
+	SampleFramework::SampleAssetManager&	m_assetManager;
+	std::vector<char*>						m_searchPaths;
+	std::vector<physx::PxFilterData>		m_FilterDatas;
+	FilterBits								*m_FilterBits;
+
+	std::vector<nvidia::apex::GroupsMask64>	m_nxGroupsMask64s;
+#if APEX_USE_PARTICLES
+	nvidia::apex::ModuleParticles*			mModuleParticles;
+#endif
+	nvidia::apex::ApexSDK*					m_apexSDK;
+	uint32_t							m_numGets;
+	SampleAssetFileType						m_assetPreference;
+};
+
+#pragma warning(pop)
+
+#endif // SAMPLE_APEX_RESOURCE_CALLBACK_H
diff --git a/APEX_1.4/shared/external/include/SampleBoxActor.h b/APEX_1.4/shared/external/include/SampleBoxActor.h
new file mode 100644
index 00000000..4919420e
--- /dev/null
+++ b/APEX_1.4/shared/external/include/SampleBoxActor.h
@@ -0,0 +1,130 @@
+/*
+ * Copyright (c) 2008-2015, NVIDIA CORPORATION.  All rights reserved.
+ *
+ * NVIDIA CORPORATION and its licensors retain all intellectual property
+ * and proprietary rights in and to this software, related documentation
+ * and any modifications thereto.  Any use, reproduction, disclosure or
+ * distribution of this software and related documentation without an express
+ * license agreement from NVIDIA CORPORATION is strictly prohibited.
+ */
+
+#ifndef __SAMPLE_BOX_ACTOR_H__
+#define __SAMPLE_BOX_ACTOR_H__
+
+#include "SampleShapeActor.h"
+#include "RendererBoxShape.h"
+
+#include "PxPhysics.h"
+#include "PxRigidDynamic.h"
+#include "PxRigidStatic.h"
+#include "geometry/PxBoxGeometry.h"
+#include "extensions/PxExtensionsAPI.h"
+namespace physx
+{
+class PxMaterial;
+}
+
+#include "RenderDebugInterface.h"
+#include <Renderer.h>
+#include <RendererMeshContext.h>
+
+class SampleBoxActor : public SampleShapeActor
+{
+public:
+	SampleBoxActor(SampleRenderer::Renderer* renderer,
+	               SampleFramework::SampleMaterialAsset& material,
+	               physx::PxScene& physxScene,
+	               const physx::PxVec3& pos,
+	               const physx::PxVec3& vel,
+	               const physx::PxVec3& extents,
+	               float density,
+	               physx::PxMaterial* PxMaterial,
+	               bool useGroupsMask,
+	               nvidia::apex::RenderDebugInterface* rdebug = NULL)
+		: SampleShapeActor(rdebug)
+		, mRendererBoxShape(NULL)
+	{
+		mRenderer = renderer;
+		if (!PxMaterial)
+			physxScene.getPhysics().getMaterials(&PxMaterial, 1);
+		createActor(physxScene, pos, vel, extents, density, PxMaterial, useGroupsMask);
+
+		mRendererBoxShape = new SampleRenderer::RendererBoxShape(*mRenderer, extents);
+
+		mRendererMeshContext.material         = material.getMaterial();
+		mRendererMeshContext.materialInstance = material.getMaterialInstance();
+		mRendererMeshContext.mesh             = mRendererBoxShape->getMesh();
+		mRendererMeshContext.transform        = &mTransform;
+
+		if (rdebug)
+		{
+			mBlockId = RENDER_DEBUG_IFACE(rdebug)->beginDrawGroup(mTransform);
+			RENDER_DEBUG_IFACE(rdebug)->addToCurrentState(RENDER_DEBUG::DebugRenderState::SolidShaded);
+			static uint32_t bcount /* = 0 */;
+			RENDER_DEBUG_IFACE(rdebug)->setCurrentColor(0xFFFFFF);
+			RENDER_DEBUG_IFACE(rdebug)->setCurrentTextScale(0.5f);
+			RENDER_DEBUG_IFACE(rdebug)->addToCurrentState(RENDER_DEBUG::DebugRenderState::CenterText);
+			RENDER_DEBUG_IFACE(rdebug)->addToCurrentState(RENDER_DEBUG::DebugRenderState::CameraFacing);
+			RENDER_DEBUG_IFACE(rdebug)->debugText(physx::PxVec3(0, extents.y + 0.01f, 0), "Sample Box:%d", bcount++);
+			RENDER_DEBUG_IFACE(rdebug)->endDrawGroup();
+		}
+	}
+
+	virtual ~SampleBoxActor()
+	{
+		if (mRendererBoxShape)
+		{
+			delete mRendererBoxShape;
+			mRendererBoxShape = NULL;
+		}
+	}
+
+private:
+	void createActor(physx::PxScene& physxScene,
+	                 const physx::PxVec3& pos,
+	                 const physx::PxVec3& vel,
+	                 const physx::PxVec3& extents,
+	                 float density,
+	                 physx::PxMaterial* PxMaterial,
+	                 bool useGroupsMask)
+	{
+		mTransform = physx::PxMat44(physx::PxIdentity);
+		mTransform.setPosition(pos);
+
+		physx::PxRigidActor* actor = NULL;
+		if (density > 0)
+		{
+			actor = physxScene.getPhysics().createRigidDynamic(physx::PxTransform(mTransform));
+			((physx::PxRigidDynamic*)actor)->setAngularDamping(0.5f);
+			((physx::PxRigidDynamic*)actor)->setLinearVelocity(vel);
+		}
+		else
+		{
+			actor = physxScene.getPhysics().createRigidStatic(physx::PxTransform(mTransform));
+		}
+		
+		PX_ASSERT(actor);
+
+		physx::PxBoxGeometry boxGeom(extents);
+		physx::PxShape* shape = actor->createShape(boxGeom, *PxMaterial);
+		PX_ASSERT(shape);
+		if (shape && useGroupsMask)
+		{
+			shape->setSimulationFilterData(physx::PxFilterData(1u, 0u, ~0u, 0u));
+			shape->setQueryFilterData(physx::PxFilterData(1u, 0u, ~0u, 0u));
+		}
+
+		if (density > 0)
+		{
+			physx::PxRigidBodyExt::updateMassAndInertia(*((physx::PxRigidDynamic*)actor), density);
+		}
+		SCOPED_PHYSX_LOCK_WRITE(&physxScene);
+		physxScene.addActor(*actor);
+		mPhysxActor = actor;
+	}
+
+private:
+	SampleRenderer::RendererBoxShape* mRendererBoxShape;
+};
+
+#endif
diff --git a/APEX_1.4/shared/external/include/SampleCapsuleActor.h b/APEX_1.4/shared/external/include/SampleCapsuleActor.h
new file mode 100644
index 00000000..1a057d95
--- /dev/null
+++ b/APEX_1.4/shared/external/include/SampleCapsuleActor.h
@@ -0,0 +1,139 @@
+/*
+ * Copyright (c) 2008-2015, NVIDIA CORPORATION.  All rights reserved.
+ *
+ * NVIDIA CORPORATION and its licensors retain all intellectual property
+ * and proprietary rights in and to this software, related documentation
+ * and any modifications thereto.  Any use, reproduction, disclosure or
+ * distribution of this software and related documentation without an express
+ * license agreement from NVIDIA CORPORATION is strictly prohibited.
+ */
+
+#ifndef __SAMPLE_CAPSULE_ACTOR_H__
+#define __SAMPLE_CAPSULE_ACTOR_H__
+
+#include "SampleShapeActor.h"
+
+#include "PxRigidDynamic.h"
+#include "geometry/PxCapsuleGeometry.h"
+#include "extensions/PxExtensionsAPI.h"
+namespace physx
+{
+class PxMaterial;
+}
+
+#include <Renderer.h>
+#include <RendererMeshContext.h>
+
+class SampleCapsuleActor : public SampleShapeActor
+{
+public:
+	SampleCapsuleActor(SampleRenderer::Renderer* renderer,
+	                   SampleFramework::SampleMaterialAsset& material,
+	                   physx::PxScene& physxScene,
+	                   const physx::PxVec3& pos,
+	                   const physx::PxVec3& vel,
+	                   float height,
+					   float radius,
+	                   float density,
+	                   physx::PxMaterial* PxMaterial,
+	                   bool useGroupsMask,
+	                   nvidia::apex::RenderDebugInterface* rdebug = NULL)
+		: SampleShapeActor(rdebug)
+		, mRendererCapsuleShape(NULL)
+		, mRadius(radius)
+		, mHeight(height)
+	{
+		mRenderer = renderer;
+		if (!PxMaterial)
+			physxScene.getPhysics().getMaterials(&PxMaterial, 1);
+		createActor(physxScene, pos, vel, radius, height, density, PxMaterial, useGroupsMask);
+
+		mRendererCapsuleShape = new SampleRenderer::RendererCapsuleShape(*mRenderer, mHeight / 2, mRadius);
+
+		mRendererMeshContext.material         = material.getMaterial();
+		mRendererMeshContext.materialInstance = material.getMaterialInstance();
+		mRendererMeshContext.mesh             = mRendererCapsuleShape->getMesh();
+		mRendererMeshContext.transform        = &mTransform;
+
+		if (rdebug)
+		{
+			mBlockId = RENDER_DEBUG_IFACE(rdebug)->beginDrawGroup(mTransform);
+			RENDER_DEBUG_IFACE(rdebug)->addToCurrentState(RENDER_DEBUG::DebugRenderState::SolidShaded);
+			static uint32_t ccount /* = 0 */;
+			RENDER_DEBUG_IFACE(rdebug)->setCurrentColor(0xFFFFFF);
+			RENDER_DEBUG_IFACE(rdebug)->setCurrentTextScale(0.5f);
+			RENDER_DEBUG_IFACE(rdebug)->addToCurrentState(RENDER_DEBUG::DebugRenderState::CenterText);
+			RENDER_DEBUG_IFACE(rdebug)->addToCurrentState(RENDER_DEBUG::DebugRenderState::CameraFacing);
+			RENDER_DEBUG_IFACE(rdebug)->debugText(physx::PxVec3(0, 1.0f + 0.01f, 0), "Sample Sphere:%d", ccount++);
+			RENDER_DEBUG_IFACE(rdebug)->endDrawGroup();
+		}
+	}
+
+	virtual ~SampleCapsuleActor()
+	{
+		if (mRendererCapsuleShape)
+		{
+			delete mRendererCapsuleShape;
+			mRendererCapsuleShape = NULL;
+		}
+	}
+
+private:
+	void createActor(physx::PxScene& physxScene,
+	                 const physx::PxVec3& pos,
+	                 const physx::PxVec3& vel,
+	                 float radius,
+	                 float height,
+	                 float density,
+	                 physx::PxMaterial* PxMaterial,
+	                 bool useGroupsMask)
+	{
+		mTransform = physx::PxMat44(physx::PxIdentity);
+		mTransform.setPosition(pos);
+
+		physx::PxRigidDynamic* actor = physxScene.getPhysics().createRigidDynamic(physx::PxTransform(mTransform));
+		PX_ASSERT(actor);
+		actor->setAngularDamping(0.5f);
+		actor->setLinearVelocity(vel);
+
+		physx::PxCapsuleGeometry capsuleGeom(radius, height * 0.5f);
+		physx::PxShape* shape = actor->createShape(capsuleGeom, *PxMaterial);
+		PX_ASSERT(shape);
+		if (shape && useGroupsMask)
+		{
+			shape->setSimulationFilterData(physx::PxFilterData(1, 0, ~0u, 0));
+			shape->setQueryFilterData(physx::PxFilterData(1, 0, ~0u, 0));
+		}
+
+		if (density > 0)
+		{
+			physx::PxRigidBodyExt::updateMassAndInertia(*actor, density);
+		}
+		else
+		{
+			actor->setMass(1.0f);
+		}
+
+		SCOPED_PHYSX_LOCK_WRITE(&physxScene);
+		physxScene.addActor(*actor);
+		mPhysxActor = actor;
+	}
+
+	/*virtual*/ physx::PxMat44		convertToGraphicalCoordinates(const physx::PxTransform & physicsPose) const
+	{
+		static const physx::PxTransform rotCcwRhZ = physx::PxTransform(physx::PxQuat(physx::PxHalfPi, physx::PxVec3(0.0f, 0.0f, 1.0f)));
+		return physx::PxMat44(physicsPose * rotCcwRhZ);
+	}
+	
+	/*virtual*/ physx::PxTransform	convertToPhysicalCoordinates(const physx::PxMat44 & graphicsPose) const
+	{
+		static const physx::PxTransform rotCwRhZ = physx::PxTransform(physx::PxQuat(-1.0f * physx::PxHalfPi, physx::PxVec3(0.0f, 0.0f, 1.0f)));
+		return physx::PxTransform(graphicsPose * rotCwRhZ);
+	}
+
+private:
+	SampleRenderer::RendererCapsuleShape*	mRendererCapsuleShape;
+	float							 mRadius, mHeight;
+};
+
+#endif
diff --git a/APEX_1.4/shared/external/include/SampleConvexMeshActor.h b/APEX_1.4/shared/external/include/SampleConvexMeshActor.h
new file mode 100644
index 00000000..9e520c05
--- /dev/null
+++ b/APEX_1.4/shared/external/include/SampleConvexMeshActor.h
@@ -0,0 +1,232 @@
+/*
+ * Copyright (c) 2008-2015, NVIDIA CORPORATION.  All rights reserved.
+ *
+ * NVIDIA CORPORATION and its licensors retain all intellectual property
+ * and proprietary rights in and to this software, related documentation
+ * and any modifications thereto.  Any use, reproduction, disclosure or
+ * distribution of this software and related documentation without an express
+ * license agreement from NVIDIA CORPORATION is strictly prohibited.
+ */
+
+#ifndef __SAMPLE_CONVEX_MESH_ACTOR_H__
+#define __SAMPLE_CONVEX_MESH_ACTOR_H__
+
+#include "SampleShapeActor.h"
+#include "RendererMeshShape.h"
+#include "PsMemoryBuffer.h"
+#include "PsArray.h"
+#include "PxStreamFromFileBuf.h"
+#include "ApexSDK.h"
+
+#include "cooking/PxCooking.h"
+#include "cooking/PxConvexMeshDesc.h"
+#include "geometry/PxConvexMeshGeometry.h"
+
+#include "PxRigidDynamic.h"
+#include "PxRigidStatic.h"
+#include "extensions/PxExtensionsAPI.h"
+
+
+
+namespace physx
+{
+class PxMaterial;
+}
+
+#include "RenderDebugInterface.h"
+#include <Renderer.h>
+#include <RendererMeshContext.h>
+
+typedef physx::PxConvexMesh ConvexMesh;
+
+class SampleConvexMeshActor : public SampleShapeActor
+{
+public:
+	SampleConvexMeshActor(SampleRenderer::Renderer* renderer,
+	               SampleFramework::SampleMaterialAsset& material,
+	               physx::PxScene& physxScene,
+				   physx::PxCooking& cooking,
+				   const physx::PxVec3* verts, 
+				   const uint32_t nbVerts,
+	               const physx::PxVec3& pos,
+	               const physx::PxVec3& vel,
+	               float density,
+	               physx::PxMaterial* PxMaterial,
+	               bool useGroupsMask,
+	               nvidia::apex::RenderDebugInterface* rdebug = NULL)
+		: SampleShapeActor(rdebug)
+		, mVerts(NULL)
+		, mNormals(NULL)
+		, mUvs(NULL)
+		, mFaces(NULL)
+		, mNbVerts(0)
+		, mNbFaces(0)
+		, mConvexMesh(NULL)
+		, mRendererMeshShape(NULL)
+	{
+		mRenderer = renderer;
+
+		createActor(physxScene, cooking, verts, nbVerts, pos, vel, density, PxMaterial, useGroupsMask);
+
+		const uint32_t   nbPolygons		= mConvexMesh->getNbPolygons();
+		const uint8_t*   indexBuffer	= mConvexMesh->getIndexBuffer();
+		const physx::PxVec3* vertices		= mConvexMesh->getVertices();
+
+		for (uint32_t i = 0; i < nbPolygons; i++)
+		{
+			physx::PxHullPolygon data;
+			bool status = mConvexMesh->getPolygonData(i, data);
+			PX_ASSERT(status);
+			PX_UNUSED(status);
+
+			uint32_t nbPolyVerts = data.mNbVerts;
+			mNbVerts += nbPolyVerts;
+			mNbFaces += (nbPolyVerts - 2)*3;
+		}
+
+		mVerts		= new physx::PxVec3[mNbVerts];
+		mNormals	= new physx::PxVec3[mNbVerts];
+		mFaces		= new uint16_t[mNbFaces];
+
+		uint32_t vertCounter = 0;
+		uint32_t facesCounter = 0;
+		for (uint32_t i = 0; i < nbPolygons; i++)
+		{
+			physx::PxHullPolygon data;
+			bool status = mConvexMesh->getPolygonData(i, data);
+			PX_ASSERT(status);
+			PX_UNUSED(status);
+
+			physx::PxVec3 normal(data.mPlane[0], data.mPlane[1], data.mPlane[2]);
+
+			uint32_t vI0 = vertCounter;
+			for (uint32_t vI = 0; vI < data.mNbVerts; vI++)
+			{
+				mVerts[vertCounter] = vertices[indexBuffer[data.mIndexBase + vI]];
+				mNormals[vertCounter] = normal;
+				vertCounter++;
+			}
+
+			for (uint32_t vI = 1; vI < uint32_t(data.mNbVerts) - 1; vI++)
+			{
+				mFaces[facesCounter++]	= uint16_t(vI0);
+				mFaces[facesCounter++]	= uint16_t(vI0 + vI + 1);
+				mFaces[facesCounter++]	= uint16_t(vI0 + vI);
+			}
+		}
+
+		mRendererMeshShape = new SampleRenderer::RendererMeshShape(*mRenderer, mVerts, mNbVerts, mNormals, mUvs, mFaces, mNbFaces / 3);
+
+		mRendererMeshContext.material         = material.getMaterial();
+		mRendererMeshContext.materialInstance = material.getMaterialInstance();
+		mRendererMeshContext.mesh             = mRendererMeshShape->getMesh();
+		mRendererMeshContext.transform        = &mTransform;
+
+		if (rdebug)
+		{
+			mBlockId = RENDER_DEBUG_IFACE(rdebug)->beginDrawGroup(mTransform);
+			RENDER_DEBUG_IFACE(rdebug)->addToCurrentState(RENDER_DEBUG::DebugRenderState::SolidShaded);
+			static uint32_t bcount /* = 0 */;
+			RENDER_DEBUG_IFACE(rdebug)->setCurrentColor(0xFFFFFF);
+			RENDER_DEBUG_IFACE(rdebug)->setCurrentTextScale(0.5f);
+			RENDER_DEBUG_IFACE(rdebug)->addToCurrentState(RENDER_DEBUG::DebugRenderState::CenterText);
+			RENDER_DEBUG_IFACE(rdebug)->addToCurrentState(RENDER_DEBUG::DebugRenderState::CameraFacing);
+			RENDER_DEBUG_IFACE(rdebug)->debugText(physx::PxVec3(0, 1.0f + 0.01f, 0), "Sample Convex Mesh:%d", bcount++);
+			RENDER_DEBUG_IFACE(rdebug)->endDrawGroup();
+		}
+	}
+
+	virtual ~SampleConvexMeshActor()
+	{
+		if (mRendererMeshShape)
+		{
+			delete[] mVerts;
+			delete[] mNormals;
+
+			delete mRendererMeshShape;
+			mRendererMeshShape = NULL;
+		}
+	}
+
+private:
+
+	void createActor(physx::PxScene& physxScene,
+					 physx::PxCooking& cooking,
+					 const physx::PxVec3* verts,
+					 const uint32_t nbVerts,
+	                 const physx::PxVec3& pos,
+	                 const physx::PxVec3& vel,
+	                 float density,
+	                 physx::PxMaterial* PxMaterial,
+					 bool useGroupsMask) 
+	{
+		if (!PxMaterial)
+		{
+			physxScene.getPhysics().getMaterials(&PxMaterial, 1);
+		}
+
+		mTransform = physx::PxMat44(physx::PxIdentity);
+		mTransform.setPosition(pos);
+
+		physx::PxRigidActor* actor = NULL;
+		if (density > 0)
+		{
+			actor = physxScene.getPhysics().createRigidDynamic(physx::PxTransform(mTransform));
+			(static_cast<physx::PxRigidDynamic*>(actor))->setAngularDamping(0.5f); // Is it correct?
+			(static_cast<physx::PxRigidDynamic*>(actor))->setLinearVelocity(vel);
+		}
+		else
+		{
+			actor = physxScene.getPhysics().createRigidStatic(physx::PxTransform(mTransform));
+		}		
+		PX_ASSERT(actor);
+
+		physx::PxConvexMeshDesc convexMeshDesc;
+		convexMeshDesc.points.count = nbVerts;
+		convexMeshDesc.points.data = verts;
+		convexMeshDesc.points.stride = sizeof(physx::PxVec3);
+		convexMeshDesc.flags = physx::PxConvexFlag::eCOMPUTE_CONVEX;
+
+		physx::PsMemoryBuffer stream;
+		stream.setEndianMode(physx::PxFileBuf::ENDIAN_NONE);
+		nvidia::apex::PxStreamFromFileBuf nvs(stream);
+
+		if (cooking.cookConvexMesh(convexMeshDesc, nvs))
+		{
+			mConvexMesh = physxScene.getPhysics().createConvexMesh(nvs);
+			PX_ASSERT(mConvexMesh);
+		}
+
+		physx::PxConvexMeshGeometry convexMeshGeom(mConvexMesh);
+		physx::PxShape* shape = actor->createShape(convexMeshGeom, *PxMaterial);
+		PX_ASSERT(shape);
+		if (shape && useGroupsMask)
+		{
+			shape->setSimulationFilterData(physx::PxFilterData(1, 0, ~0u, 0));
+			shape->setQueryFilterData(physx::PxFilterData(1, 0, ~0u, 0));
+		}
+
+		if (density > 0)
+		{
+			physx::PxRigidBodyExt::updateMassAndInertia(*(static_cast<physx::PxRigidDynamic*>(actor)), density); // () -> static_cast
+		}
+		SCOPED_PHYSX_LOCK_WRITE(&physxScene);
+		physxScene.addActor(*actor);
+		mPhysxActor = actor;
+	}
+
+private:
+	physx::PxVec3*	mVerts;
+	physx::PxVec3*	mNormals;
+	float*	mUvs;
+	uint16_t*	mFaces;
+
+	uint32_t	mNbVerts;
+	uint32_t	mNbFaces;
+
+	ConvexMesh*		mConvexMesh;
+
+	SampleRenderer::RendererMeshShape* mRendererMeshShape;
+};
+
+#endif
diff --git a/APEX_1.4/shared/external/include/SamplePlaneActor.h b/APEX_1.4/shared/external/include/SamplePlaneActor.h
new file mode 100644
index 00000000..65b7b2f0
--- /dev/null
+++ b/APEX_1.4/shared/external/include/SamplePlaneActor.h
@@ -0,0 +1,115 @@
+/*
+ * Copyright (c) 2008-2015, NVIDIA CORPORATION.  All rights reserved.
+ *
+ * NVIDIA CORPORATION and its licensors retain all intellectual property
+ * and proprietary rights in and to this software, related documentation
+ * and any modifications thereto.  Any use, reproduction, disclosure or
+ * distribution of this software and related documentation without an express
+ * license agreement from NVIDIA CORPORATION is strictly prohibited.
+ */
+
+#ifndef __SAMPLE_PLANE_ACTOR_H__
+#define __SAMPLE_PLANE_ACTOR_H__
+
+#include "SampleShapeActor.h"
+
+#include "PxScene.h"
+#include "PxRigidStatic.h"
+#include "geometry/PxPlaneGeometry.h"
+namespace physx
+{
+class PxMaterial;
+}
+
+#include <PsMathUtils.h>
+
+#include <Renderer.h>
+#include <RendererMeshContext.h>
+#include <RendererGridShape.h>
+
+
+class SamplePlaneActor : public SampleShapeActor
+{
+public:
+	SamplePlaneActor(SampleRenderer::Renderer* renderer,
+	                 SampleFramework::SampleMaterialAsset& material,
+	                 physx::PxScene& physxScene,
+	                 const physx::PxVec3& pos,
+	                 const physx::PxVec3& normal,
+	                 physx::PxMaterial* PxMaterial,
+	                 bool useGroupsMask,
+	                 nvidia::apex::RenderDebugInterface* rdebug = NULL)
+		: SampleShapeActor(rdebug)
+		, mRendererGridShape(NULL)
+	{
+		mRenderer = renderer;
+		if (!PxMaterial)
+			physxScene.getPhysics().getMaterials(&PxMaterial, 1);
+		createActor(physxScene, pos, normal, PxMaterial, useGroupsMask);
+
+		// default is X_UP
+		mRendererGridShape = new SampleRenderer::RendererGridShape(*mRenderer, 10, 1.0f, false, SampleRenderer::RendererGridShape::UP_X);
+
+		mRendererMeshContext.material         = material.getMaterial();
+		mRendererMeshContext.materialInstance = material.getMaterialInstance();
+		mRendererMeshContext.mesh             = mRendererGridShape->getMesh();
+		mRendererMeshContext.transform        = &mTransform;
+
+		if (rdebug)
+		{
+			mBlockId = RENDER_DEBUG_IFACE(rdebug)->beginDrawGroup(mTransform);
+			RENDER_DEBUG_IFACE(rdebug)->addToCurrentState(RENDER_DEBUG::DebugRenderState::SolidShaded);
+			static uint32_t pcount /* = 0 */;
+			RENDER_DEBUG_IFACE(rdebug)->setCurrentColor(0xFFFFFF);
+			RENDER_DEBUG_IFACE(rdebug)->setCurrentTextScale(0.5f);
+			RENDER_DEBUG_IFACE(rdebug)->addToCurrentState(RENDER_DEBUG::DebugRenderState::CenterText);
+			RENDER_DEBUG_IFACE(rdebug)->addToCurrentState(RENDER_DEBUG::DebugRenderState::CameraFacing);
+			RENDER_DEBUG_IFACE(rdebug)->debugText(physx::PxVec3(0, 1.0f + 0.01f, 0), "Sample Plane:%d", pcount++);
+			RENDER_DEBUG_IFACE(rdebug)->endDrawGroup();
+		}
+	}
+
+	virtual ~SamplePlaneActor()
+	{
+		if (mRendererGridShape)
+		{
+			delete mRendererGridShape;
+			mRendererGridShape = NULL;
+		}
+	}
+
+private:
+	void createActor(physx::PxScene& physxScene,
+	                 const physx::PxVec3& pos,
+	                 const physx::PxVec3& normal,
+	                 physx::PxMaterial* PxMaterial,
+	                 bool useGroupsMask)
+	{
+		//physx::PxMat33 m33(nvidia::rotFrom2Vectors(physx::PxVec3(0, 1, 0), normal));
+		physx::PxMat33 m33(physx::shdfnd::rotFrom2Vectors(physx::PxVec3(1, 0, 0), normal));
+		mTransform = physx::PxMat44(m33, pos);
+
+		//physx::PxTransform pose(pos, physx::PxQuat(nvidia::rotFrom2Vectors(physx::PxVec3(1, 0, 0), normal)));
+		physx::PxTransform pose	= physx::PxTransform(mTransform);
+		pose.q.normalize();
+		physx::PxRigidStatic* actor = physxScene.getPhysics().createRigidStatic(pose);
+		PX_ASSERT(actor);
+
+		physx::PxPlaneGeometry planeGeom;
+		physx::PxShape* shape = actor->createShape(planeGeom, *PxMaterial);
+		PX_ASSERT(shape);
+		if (shape && useGroupsMask)
+		{
+			shape->setSimulationFilterData(physx::PxFilterData(1, 0, ~0u, 0));
+			shape->setQueryFilterData(physx::PxFilterData(1, 0, ~0u, 0));
+		}
+		SCOPED_PHYSX_LOCK_WRITE(&physxScene);
+		physxScene.addActor(*actor);
+		mPhysxActor = actor;
+	}
+
+private:
+	SampleRenderer::RendererGridShape* mRendererGridShape;
+};
+
+#endif
diff --git a/APEX_1.4/shared/external/include/SampleShapeActor.h b/APEX_1.4/shared/external/include/SampleShapeActor.h
new file mode 100644
index 00000000..87988445
--- /dev/null
+++ b/APEX_1.4/shared/external/include/SampleShapeActor.h
@@ -0,0 +1,204 @@
+/*
+ * Copyright (c) 2008-2015, NVIDIA CORPORATION.  All rights reserved.
+ *
+ * NVIDIA CORPORATION and its licensors retain all intellectual property
+ * and proprietary rights in and to this software, related documentation
+ * and any modifications thereto.  Any use, reproduction, disclosure or
+ * distribution of this software and related documentation without an express
+ * license agreement from NVIDIA CORPORATION is strictly prohibited.
+ */
+
+#ifndef __SAMPLE_SHAPE_ACTOR_H__
+#define __SAMPLE_SHAPE_ACTOR_H__
+
+#include "SampleActor.h"
+#include "ApexDefs.h"
+#include "PxActor.h"
+#include "PxRigidDynamic.h"
+#include "PxScene.h"
+
+#if PX_PHYSICS_VERSION_MAJOR == 3
+#include "ScopedPhysXLock.h"
+#endif
+#include "RenderDebugInterface.h"
+#include <Renderer.h>
+#include <RendererMeshContext.h>
+
+
+#if PX_PHYSICS_VERSION_MAJOR == 0
+namespace physx
+{
+namespace apex
+{
+/**
+\brief A scoped object for acquiring/releasing read/write lock of a PhysX scene
+*/
+class ScopedPhysXLockRead
+{
+public:
+	/**
+	\brief Ctor
+	*/
+	ScopedPhysXLockRead(PxScene *scene,const char *fileName,int lineno) : mScene(scene)
+	{
+		if ( mScene )
+		{
+			mScene->lockRead(fileName, (physx::PxU32)lineno);
+		}
+	}
+	~ScopedPhysXLockRead()
+	{
+		if ( mScene )
+		{
+			mScene->unlockRead();
+		}
+	}
+private:
+	PxScene* mScene;
+};
+
+/**
+\brief A scoped object for acquiring/releasing read/write lock of a PhysX scene
+*/
+class ScopedPhysXLockWrite
+{
+public:
+	/**
+	\brief Ctor
+	*/
+	ScopedPhysXLockWrite(PxScene *scene,const char *fileName,int lineno) : mScene(scene)
+	{
+		if ( mScene ) 
+		{
+			mScene->lockWrite(fileName, (physx::PxU32)lineno);
+		}
+	}
+	~ScopedPhysXLockWrite()
+	{
+		if ( mScene )
+		{
+			mScene->unlockWrite();
+		}
+	}
+private:
+	PxScene* mScene;
+};
+
+}; // end apx namespace
+}; // end physx namespace
+
+
+#if defined(_DEBUG) || defined(PX_CHECKED)
+#define SCOPED_PHYSX_LOCK_WRITE(x) physx::apex::ScopedPhysXLockWrite _wlock(x,__FILE__,__LINE__);
+#else
+#define SCOPED_PHYSX_LOCK_WRITE(x) physx::apex::ScopedPhysXLockWrite _wlock(x,"",__LINE__);
+#endif
+
+#if defined(_DEBUG) || defined(PX_CHECKED)
+#define SCOPED_PHYSX_LOCK_READ(x) physx::apex::ScopedPhysXLockRead _rlock(x,__FILE__,__LINE__);
+#else
+#define SCOPED_PHYSX_LOCK_READ(x) physx::apex::ScopedPhysXLockRead _rlock(x,"",__LINE__);
+#endif
+
+#endif // PX_PHYSICS_VERSION_MAJOR
+
+
+
+class SampleShapeActor : public SampleFramework::SampleActor
+{
+public:
+	SampleShapeActor(nvidia::apex::RenderDebugInterface* rdebug)
+		: mBlockId(-1)
+		, mApexRenderDebug(rdebug)
+		, mRenderer(NULL)
+		, mPhysxActor(NULL)
+	{
+	}
+
+	virtual ~SampleShapeActor(void)
+	{
+		if (mApexRenderDebug != NULL)
+		{
+			RENDER_DEBUG_IFACE(mApexRenderDebug)->reset(mBlockId);
+		}
+
+		if (mPhysxActor)
+		{
+			SCOPED_PHYSX_LOCK_WRITE(mPhysxActor->getScene());
+			mPhysxActor->release();
+		}
+	}
+
+	physx::PxTransform getPose() const
+	{
+		return physx::PxTransform(mTransform);
+	}
+
+	void setPose(const physx::PxTransform& pose)
+	{
+		mTransform = physx::PxMat44(pose);
+		if (mPhysxActor)
+		{
+			SCOPED_PHYSX_LOCK_WRITE(mPhysxActor->getScene());
+			if (physx::PxRigidDynamic* rd = mPhysxActor->is<physx::PxRigidDynamic>())
+			{
+				rd->setGlobalPose(this->convertToPhysicalCoordinates(mTransform));
+			}
+		}
+		if (mApexRenderDebug != NULL)
+		{
+			RENDER_DEBUG_IFACE(mApexRenderDebug)->setDrawGroupPose(mBlockId, mTransform);
+		}
+	}
+
+	virtual void tick(float dtime, bool rewriteBuffers = false)
+	{
+		if (mPhysxActor)
+		{
+			physx::PxRigidDynamic* rd = mPhysxActor->is<physx::PxRigidDynamic>();
+			SCOPED_PHYSX_LOCK_READ(mPhysxActor->getScene());
+			if (rd && !rd->isSleeping())
+			{
+				mTransform = this->convertToGraphicalCoordinates(rd->getGlobalPose());
+				if (mApexRenderDebug != NULL)
+				{
+					RENDER_DEBUG_IFACE(mApexRenderDebug)->setDrawGroupPose(mBlockId, mTransform);
+				}
+			}
+		}
+	}
+
+	physx::PxActor* getPhysXActor()
+	{
+		return mPhysxActor;
+	}
+
+	virtual void render(bool /*rewriteBuffers*/ = false)
+	{
+		if (mRenderer)
+		{
+			mRenderer->queueMeshForRender(mRendererMeshContext);
+		}
+	}
+
+protected:
+	int32_t								mBlockId;
+	nvidia::apex::RenderDebugInterface*			mApexRenderDebug;
+	SampleRenderer::Renderer*			mRenderer;
+	SampleRenderer::RendererMeshContext	mRendererMeshContext;
+	physx::PxMat44						mTransform; 
+	physx::PxActor*						mPhysxActor;
+
+private:
+	virtual physx::PxMat44		convertToGraphicalCoordinates(const physx::PxTransform & physicsPose) const
+	{
+		return physx::PxMat44(physicsPose);
+	}
+
+	virtual physx::PxTransform	convertToPhysicalCoordinates(const physx::PxMat44 & graphicsPose) const
+	{
+		return physx::PxTransform(graphicsPose);
+	}
+};
+
+#endif
diff --git a/APEX_1.4/shared/external/include/SampleSphereActor.h b/APEX_1.4/shared/external/include/SampleSphereActor.h
new file mode 100644
index 00000000..3bd68204
--- /dev/null
+++ b/APEX_1.4/shared/external/include/SampleSphereActor.h
@@ -0,0 +1,125 @@
+/*
+ * Copyright (c) 2008-2015, NVIDIA CORPORATION.  All rights reserved.
+ *
+ * NVIDIA CORPORATION and its licensors retain all intellectual property
+ * and proprietary rights in and to this software, related documentation
+ * and any modifications thereto.  Any use, reproduction, disclosure or
+ * distribution of this software and related documentation without an express
+ * license agreement from NVIDIA CORPORATION is strictly prohibited.
+ */
+
+#ifndef __SAMPLE_SPHERE_ACTOR_H__
+#define __SAMPLE_SPHERE_ACTOR_H__
+
+#include "SampleShapeActor.h"
+#include "RendererCapsuleShape.h"
+
+#include "PxRigidDynamic.h"
+#include "geometry/PxSphereGeometry.h"
+#include "extensions/PxExtensionsAPI.h"
+namespace physx
+{
+class PxMaterial;
+}
+
+#include <Renderer.h>
+#include <RendererMeshContext.h>
+
+
+class SampleSphereActor : public SampleShapeActor
+{
+public:
+	SampleSphereActor(SampleRenderer::Renderer* renderer,
+	                  SampleFramework::SampleMaterialAsset& material,
+	                  physx::PxScene& physxScene,
+	                  const physx::PxVec3& pos,
+	                  const physx::PxVec3& vel,
+	                  const physx::PxVec3& radius,
+	                  float density,
+	                  physx::PxMaterial* PxMaterial,
+	                  bool useGroupsMask,
+	                  nvidia::apex::RenderDebugInterface* rdebug = NULL)
+		: SampleShapeActor(rdebug)
+		, mRendererCapsuleShape(NULL)
+		, mRadius(radius)
+	{
+		mRenderer = renderer;
+		if (!PxMaterial)
+			physxScene.getPhysics().getMaterials(&PxMaterial, 1);
+		createActor(physxScene, pos, vel, mRadius, density, PxMaterial, useGroupsMask);
+
+		mRendererCapsuleShape = new SampleRenderer::RendererCapsuleShape(*mRenderer, 0, radius.x);
+
+		mRendererMeshContext.material         = material.getMaterial();
+		mRendererMeshContext.materialInstance = material.getMaterialInstance();
+		mRendererMeshContext.mesh             = mRendererCapsuleShape->getMesh();
+		mRendererMeshContext.transform        = &mTransform;
+
+		if (rdebug)
+		{
+			mBlockId = RENDER_DEBUG_IFACE(rdebug)->beginDrawGroup(mTransform);
+			RENDER_DEBUG_IFACE(rdebug)->addToCurrentState(RENDER_DEBUG::DebugRenderState::SolidShaded);
+			static uint32_t scount /* = 0 */;
+			RENDER_DEBUG_IFACE(rdebug)->setCurrentColor(0xFFFFFF);
+			RENDER_DEBUG_IFACE(rdebug)->setCurrentTextScale(0.5f);
+			RENDER_DEBUG_IFACE(rdebug)->addToCurrentState(RENDER_DEBUG::DebugRenderState::CenterText);
+			RENDER_DEBUG_IFACE(rdebug)->addToCurrentState(RENDER_DEBUG::DebugRenderState::CameraFacing);
+			RENDER_DEBUG_IFACE(rdebug)->debugText(physx::PxVec3(0, 1.0f + 0.01f, 0), "Sample Sphere:%d", scount++);
+			RENDER_DEBUG_IFACE(rdebug)->endDrawGroup();
+		}
+	}
+
+	virtual ~SampleSphereActor()
+	{
+		if (mRendererCapsuleShape)
+		{
+			delete mRendererCapsuleShape;
+			mRendererCapsuleShape = NULL;
+		}
+	}
+
+private:
+	void createActor(physx::PxScene& physxScene,
+	                 const physx::PxVec3& pos,
+	                 const physx::PxVec3& vel,
+	                 const physx::PxVec3& extents,
+	                 float density,
+	                 physx::PxMaterial* PxMaterial,
+	                 bool useGroupsMask)
+	{
+		mTransform = physx::PxMat44(physx::PxIdentity);
+		mTransform.setPosition(pos);
+
+		physx::PxRigidDynamic* actor = physxScene.getPhysics().createRigidDynamic(physx::PxTransform(mTransform));
+		PX_ASSERT(actor);
+		actor->setAngularDamping(0.5f);
+		actor->setLinearVelocity(vel);
+
+		physx::PxSphereGeometry sphereGeom(extents.x);
+		physx::PxShape* shape = actor->createShape(sphereGeom, *PxMaterial);
+		PX_ASSERT(shape);
+		if (shape && useGroupsMask)
+		{
+			shape->setSimulationFilterData(physx::PxFilterData(1, 0, ~0u, 0));
+			shape->setQueryFilterData(physx::PxFilterData(1, 0, ~0u, 0));
+		}
+
+		if (density > 0)
+		{
+			physx::PxRigidBodyExt::updateMassAndInertia(*actor, density);
+		}
+		else
+		{
+			actor->setMass(1.0f);
+		}
+		SCOPED_PHYSX_LOCK_WRITE(&physxScene);
+		physxScene.addActor(*actor);
+		mPhysxActor = actor;
+	}
+
+private:
+	SampleRenderer::RendererCapsuleShape* mRendererCapsuleShape;
+	physx::PxVec3 mRadius;
+};
+
+#endif
diff --git a/APEX_1.4/shared/external/include/SampleTriMeshActor.h b/APEX_1.4/shared/external/include/SampleTriMeshActor.h
new file mode 100644
index 00000000..c18772cd
--- /dev/null
+++ b/APEX_1.4/shared/external/include/SampleTriMeshActor.h
@@ -0,0 +1,264 @@
+/*
+ * Copyright (c) 2008-2015, NVIDIA CORPORATION.  All rights reserved.
+ *
+ * NVIDIA CORPORATION and its licensors retain all intellectual property
+ * and proprietary rights in and to this software, related documentation
+ * and any modifications thereto.  Any use, reproduction, disclosure or
+ * distribution of this software and related documentation without an express
+ * license agreement from NVIDIA CORPORATION is strictly prohibited.
+ */
+
+#ifndef __SAMPLE_TRI_MESH_ACTOR_H__
+#define __SAMPLE_TRI_MESH_ACTOR_H__
+
+#include "SampleShapeActor.h"
+#include "RendererMeshShape.h"
+#include "PsMemoryBuffer.h"
+#include "PsArray.h"
+#include "PxStreamFromFileBuf.h"
+#include "ApexSDK.h"
+
+#include "cooking/PxCooking.h"
+#include "cooking/PxConvexMeshDesc.h"
+#include "geometry/PxConvexMeshGeometry.h"
+
+#include "geometry/PxTriangleMesh.h"
+#include "cooking/PxTriangleMeshDesc.h"
+#include "geometry/PxTriangleMeshGeometry.h"
+
+#include "PxRigidDynamic.h"
+#include "PxRigidStatic.h"
+#include "extensions/PxExtensionsAPI.h"
+
+
+
+namespace physx
+{
+class PxMaterial;
+}
+
+#include "RenderDebugInterface.h"
+#include <Renderer.h>
+#include <RendererMeshContext.h>
+
+//typedef physx::PxConvexMesh ConvexMesh;
+typedef physx::PxTriangleMesh TriMesh;
+
+class SampleTriMeshActor : public SampleShapeActor
+{
+public:
+
+	SampleTriMeshActor(SampleRenderer::Renderer* renderer,
+	               SampleFramework::SampleMaterialAsset& material,
+	               physx::PxScene& physxScene,
+				   physx::PxCooking& cooking,
+				   const physx::PxVec3* verts, 
+				   const uint32_t nbVerts,
+				   const uint32_t* indices,
+				   const uint32_t nbIndices,
+				   float* uvs,
+	               const physx::PxVec3& pos,
+	               const physx::PxVec3& vel,
+	               float density,
+	               physx::PxMaterial* PxMaterial,
+	               bool useGroupsMask,
+	               nvidia::apex::RenderDebugInterface* rdebug = NULL)
+		: SampleShapeActor(rdebug)
+		, mVerts(NULL)
+		, mNormals(NULL)
+		, mUvs(NULL)
+		, mFaces(NULL)
+		, mNbVerts(0)
+		, mNbFaces(0)
+		, mTriMesh(NULL)
+		, mRendererMeshShape(NULL)
+	{
+		mRenderer = renderer;
+
+		createActor(physxScene, cooking, verts, nbVerts, indices, nbIndices, pos, vel, density, PxMaterial, useGroupsMask);
+
+		const bool has16BitIndices = (mTriMesh->getTriangleMeshFlags() & physx::PxTriangleMeshFlag::e16_BIT_INDICES);
+
+		const uint32_t   nbTris			= mTriMesh->getNbTriangles();
+		const uint32_t*  indexBuffer	= (uint32_t*) (has16BitIndices ? NULL : mTriMesh->getTriangles());
+		const uint16_t*  indexBuffer16	= (uint16_t*) (has16BitIndices ? mTriMesh->getTriangles() : NULL);
+		const physx::PxVec3* vertices		= mTriMesh->getVertices();
+
+		mNbVerts = 3*nbTris;
+		mNbFaces = 3*nbTris;
+
+		mVerts		= new physx::PxVec3[mNbVerts];
+		mNormals	= new physx::PxVec3[mNbVerts];
+		mFaces		= new uint16_t[mNbFaces];
+		if (uvs != NULL)
+		{
+			mUvs		= new float[mNbVerts * 2];
+		}
+
+		if(indexBuffer)
+		{
+			for (uint32_t i = 0; i < nbTris; i++)
+			{
+				const physx::PxVec3& A( vertices[indexBuffer[3*i+0]] );
+				const physx::PxVec3& B( vertices[indexBuffer[3*i+1]] );
+				const physx::PxVec3& C( vertices[indexBuffer[3*i+2]] );
+
+				physx::PxVec3 a(B-A),b(C-A);
+				physx::PxVec3 normal = a.cross(b);
+				normal.normalize();
+
+				mVerts[3*i+0] = A;
+				mVerts[3*i+1] = C;
+				mVerts[3*i+2] = B;
+				mNormals[3*i+0] = normal;
+				mNormals[3*i+1] = normal;
+				mNormals[3*i+2] = normal;
+				mFaces[3*i+0] = uint16_t(3*i+0);
+				mFaces[3*i+1] = uint16_t(3*i+1);
+				mFaces[3*i+2] = uint16_t(3*i+2);
+			}
+		}
+		else if(indexBuffer16)
+		{
+			for (uint32_t i = 0; i < nbTris; i++)
+			{
+				const physx::PxVec3& A( verts[indices[3*i+0]] );
+				const physx::PxVec3& B( verts[indices[3*i+1]] );
+				const physx::PxVec3& C( verts[indices[3*i+2]] );
+
+				physx::PxVec3 a(B-A),b(C-A);
+				physx::PxVec3 normal = a.cross(b);
+				normal.normalize();
+
+				mVerts[3*i+0] = A;
+				mVerts[3*i+1] = C;
+				mVerts[3*i+2] = B;
+				if (uvs != NULL)
+				{
+					mUvs[6*i+0] = uvs[2*indices[3*i+0]];
+					mUvs[6*i+1] = uvs[2*indices[3*i+0] + 1];
+					mUvs[6*i+2] = uvs[2*indices[3*i+2]];
+					mUvs[6*i+3] = uvs[2*indices[3*i+2] + 1];
+					mUvs[6*i+4] = uvs[2*indices[3*i+1]];
+					mUvs[6*i+5] = uvs[2*indices[3*i+1] + 1];
+				}
+				mNormals[3*i+0] = normal;
+				mNormals[3*i+1] = normal;
+				mNormals[3*i+2] = normal;
+				mFaces[3*i+0] = uint16_t(3*i+0);
+				mFaces[3*i+1] = uint16_t(3*i+1);
+				mFaces[3*i+2] = uint16_t(3*i+2);
+			}
+		}
+		else
+		{
+			PX_ASSERT(0 && "Invalid Index Data");
+		}
+
+		mRendererMeshShape = new SampleRenderer::RendererMeshShape(*mRenderer, mVerts, mNbVerts, mNormals, mUvs, mFaces, mNbFaces / 3);
+
+		mRendererMeshContext.material         = material.getMaterial();
+		mRendererMeshContext.materialInstance = material.getMaterialInstance();
+		mRendererMeshContext.mesh             = mRendererMeshShape->getMesh();
+		mRendererMeshContext.transform        = &mTransform;
+
+		if (RENDER_DEBUG_IFACE(rdebug))
+		{
+			mBlockId = RENDER_DEBUG_IFACE(rdebug)->beginDrawGroup(mTransform);
+			RENDER_DEBUG_IFACE(rdebug)->addToCurrentState(RENDER_DEBUG::DebugRenderState::SolidShaded);
+			static uint32_t bcount /* = 0 */;
+			RENDER_DEBUG_IFACE(rdebug)->setCurrentColor(0xFFFFFF);
+			RENDER_DEBUG_IFACE(rdebug)->setCurrentTextScale(0.5f);
+			RENDER_DEBUG_IFACE(rdebug)->addToCurrentState(RENDER_DEBUG::DebugRenderState::CenterText);
+			RENDER_DEBUG_IFACE(rdebug)->addToCurrentState(RENDER_DEBUG::DebugRenderState::CameraFacing);
+			RENDER_DEBUG_IFACE(rdebug)->debugText(physx::PxVec3(0, 1.0f + 0.01f, 0), "Sample Triangle Mesh:%d", bcount++);
+			RENDER_DEBUG_IFACE(rdebug)->endDrawGroup();
+		}
+	}
+
+	virtual ~SampleTriMeshActor()
+	{
+		if (mRendererMeshShape)
+		{
+			delete[] mVerts;
+			delete[] mNormals;
+
+			delete mRendererMeshShape;
+			mRendererMeshShape = NULL;
+		}
+	}
+
+private:
+
+	void createActor(physx::PxScene& physxScene,
+					 physx::PxCooking& cooking,
+					 const physx::PxVec3* verts,
+					 const uint32_t nbVerts,
+					 const uint32_t* indices,
+					 const uint32_t nbIndices,
+	                 const physx::PxVec3& pos,
+	                 const physx::PxVec3& vel,
+	                 float density,
+	                 physx::PxMaterial* PxMaterial,
+					 bool useGroupsMask) 
+	{
+		if (!PxMaterial)
+		{
+			physxScene.getPhysics().getMaterials(&PxMaterial, 1);
+		}
+
+		mTransform = physx::PxMat44(physx::PxIdentity);
+		mTransform.setPosition(pos);	
+
+		physx::PxRigidActor* actor = NULL;
+		actor = physxScene.getPhysics().createRigidStatic(physx::PxTransform(mTransform));
+
+		physx::PxTriangleMeshDesc triMeshDesc;
+		triMeshDesc.points.count = nbVerts;
+		triMeshDesc.points.data = verts;
+		triMeshDesc.points.stride = sizeof(physx::PxVec3);
+		triMeshDesc.triangles.count = nbIndices/3;
+		triMeshDesc.triangles.data = indices;
+		triMeshDesc.triangles.stride = 3*sizeof(uint32_t);
+
+		physx::PsMemoryBuffer stream;
+		stream.setEndianMode(physx::PxFileBuf::ENDIAN_NONE);
+		nvidia::apex::PxStreamFromFileBuf nvs(stream);
+
+		if (cooking.cookTriangleMesh(triMeshDesc, nvs))
+		{
+			mTriMesh = physxScene.getPhysics().createTriangleMesh(nvs);
+			PX_ASSERT(mTriMesh);
+		}
+
+		physx::PxTriangleMeshGeometry triMeshGeom(mTriMesh);
+		physx::PxShape* shape = actor->createShape(triMeshGeom, *PxMaterial);
+		PX_ASSERT(shape);
+		if (shape && useGroupsMask)
+		{
+			shape->setSimulationFilterData(physx::PxFilterData(1, 0, ~0u, 0));
+			shape->setQueryFilterData(physx::PxFilterData(1, 0, ~0u, 0));
+		}
+		{
+			physxScene.lockWrite(__FILE__, __LINE__);
+			physxScene.addActor(*actor);
+			physxScene.unlockWrite();
+		}		
+		mPhysxActor = actor;
+	}
+
+private:
+	physx::PxVec3*	mVerts;
+	physx::PxVec3*	mNormals;
+	float*	mUvs;
+	uint16_t*	mFaces;
+
+	uint32_t	mNbVerts;
+	uint32_t	mNbFaces;
+
+	TriMesh* mTriMesh;
+
+	SampleRenderer::RendererMeshShape* mRendererMeshShape;
+};
+
+#endif
diff --git a/APEX_1.4/shared/external/include/SimpleErrorStream.h b/APEX_1.4/shared/external/include/SimpleErrorStream.h
new file mode 100644
index 00000000..0d8d52bd
--- /dev/null
+++ b/APEX_1.4/shared/external/include/SimpleErrorStream.h
@@ -0,0 +1,66 @@
+/*
+ * Copyright (c) 2008-2015, NVIDIA CORPORATION.  All rights reserved.
+ *
+ * NVIDIA CORPORATION and its licensors retain all intellectual property
+ * and proprietary rights in and to this software, related documentation
+ * and any modifications thereto.  Any use, reproduction, disclosure or
+ * distribution of this software and related documentation without an express
+ * license agreement from NVIDIA CORPORATION is strictly prohibited.
+ */
+
+#include "PxErrorCallback.h"
+
+#include <ApexDefs.h>
+
+class SimplePxErrorStream : public physx::PxErrorCallback
+{
+	virtual void reportError(physx::PxErrorCode::Enum code, const char* message, const char* file, int line)
+	{
+		const char* errorCode = NULL;
+		switch (code)
+		{
+		case physx::PxErrorCode::eNO_ERROR :
+			return;
+		case physx::PxErrorCode::eINVALID_PARAMETER:
+			errorCode = "Invalid Parameter";
+			break;
+		case physx::PxErrorCode::eINVALID_OPERATION:
+			errorCode = "Invalid Operation";
+			break;
+		case physx::PxErrorCode::eOUT_OF_MEMORY:
+			errorCode = "Out of Memory";
+			break;
+		case physx::PxErrorCode::eINTERNAL_ERROR :
+			errorCode = "Internal Error";
+			break;
+//		case physx::PxErrorCode::eASSERTION:
+//			errorCode = "Assertion";
+//			break;
+		case physx::PxErrorCode::eDEBUG_INFO:
+			errorCode = "Debug Info";
+			break;
+		case physx::PxErrorCode::eDEBUG_WARNING:
+			errorCode = "Debug Warning";
+			break;
+//		case physx::PxErrorCode::eSERIALIZATION_ERROR:
+//			errorCode = "Serialization Error";
+//			break;
+		default:
+			errorCode = "Unknown Error Code";
+		}
+
+		if (errorCode != NULL)
+		{
+			printf("PhysX error: %s %s:%d\n%s\n", errorCode, file, line, message);
+		}
+		else
+		{
+			printf("PhysX error: physx::PxErrorCode is %d in %s:%d\n%s\n", code, file, line, message);
+		}
+	}
+
+	virtual void print(const char* message)
+	{
+		printf("%s", message);
+	}
+};
diff --git a/APEX_1.4/shared/external/include/SkeletalAnim.h b/APEX_1.4/shared/external/include/SkeletalAnim.h
new file mode 100644
index 00000000..3942e242
--- /dev/null
+++ b/APEX_1.4/shared/external/include/SkeletalAnim.h
@@ -0,0 +1,229 @@
+/*
+ * Copyright (c) 2008-2015, NVIDIA CORPORATION.  All rights reserved.
+ *
+ * NVIDIA CORPORATION and its licensors retain all intellectual property
+ * and proprietary rights in and to this software, related documentation
+ * and any modifications thereto.  Any use, reproduction, disclosure or
+ * distribution of this software and related documentation without an express
+ * license agreement from NVIDIA CORPORATION is strictly prohibited.
+ */
+
+#ifndef SKELETAL_ANIM
+#define SKELETAL_ANIM
+
+#include <PsFastXml.h>
+#include <vector>
+#include "TriangleMesh.h"
+
+#include "ApexDefs.h"
+
+namespace MESHIMPORT
+{
+};
+
+namespace nvidia
+{
+namespace apex
+{
+class RenderDebugInterface;
+class RenderMeshAssetAuthoring;
+}
+}
+
+namespace mimp
+{
+	class MeshSystemContainer;
+};
+
+namespace Samples
+{
+
+class TriangleMesh;
+
+// ---------------------------------------------------------------------------
+struct SkeletalBone
+{
+	void clear();
+
+	std::string name;
+	int id;
+	physx::PxTransform pose;
+	physx::PxVec3 scale;
+	int parent;
+	int firstChild;
+	int numChildren;
+	int firstVertex;
+
+	physx::PxMat44 bindWorldPose;
+	physx::PxMat44 invBindWorldPose;
+	physx::PxMat44 currentWorldPose;
+	int boneOption;
+	float inflateConvex;
+	float minimalBoneWeight;
+	int numShapes;
+	bool selected;
+	bool isRoot; // this is used for localspace sim
+	bool isRootLock; // this is used to lock the translation of the rootbone
+	bool allowPrimitives;
+	bool dirtyParams;
+	bool manualShapes;
+};
+
+struct BoneKeyFrame
+{
+	void clear();
+	physx::PxTransform relPose;
+	float time;
+	physx::PxVec3 scale;
+};
+
+struct BoneTrack
+{
+	void clear();
+	int firstFrame;
+	int numFrames;
+};
+
+struct SkeletalAnimation
+{
+	void clear();
+	std::string name;
+	std::vector<BoneTrack> mBoneTracks;
+	float minTime;
+	float maxTime;
+};
+
+// ---------------------------------------------------------------------------
+class SkeletalAnim : public physx::shdfnd::FastXml::Callback
+{
+public:
+	SkeletalAnim();
+	virtual ~SkeletalAnim();
+
+	void clear();
+	void copyFrom(const SkeletalAnim& anim);
+
+	bool loadFromXML(const std::string& xmlFile, std::string& error);
+	bool saveToXML(const std::string& xmlFile) const;
+	bool loadFromParent(const SkeletalAnim* parent);
+	bool loadFromMeshImport(mimp::MeshSystemContainer* msc, std::string& error, bool onlyAddAnimation);
+	bool saveToMeshImport(mimp::MeshSystemContainer* msc);
+	bool initFrom(nvidia::apex::RenderMeshAssetAuthoring& rma);
+
+	void setBindPose();
+	void setAnimPose(int animNr, float time, bool lockRootbone = false);
+	const std::vector<SkeletalBone> &getBones() const
+	{
+		return mBones;
+	}
+	void setBoneCollision(uint32_t boneNr, int option);
+	void setBoneSelected(uint32_t boneNr, bool selected)
+	{
+		mBones[boneNr].selected = selected;
+	}
+	void setBoneRoot(uint32_t boneNr, bool isRoot)
+	{
+		mBones[boneNr].isRoot = isRoot;
+	}
+	void setBoneAllowPrimitives(uint32_t boneNr, bool on)
+	{
+		mBones[boneNr].dirtyParams |= mBones[boneNr].allowPrimitives != on;
+		mBones[boneNr].allowPrimitives = on;
+	}
+	void setBoneInflation(uint32_t boneNr, float value)
+	{
+		mBones[boneNr].inflateConvex = value;
+	}
+	void setBoneMinimalWeight(uint32_t boneNr, float value)
+	{
+		mBones[boneNr].dirtyParams |= mBones[boneNr].minimalBoneWeight != value;
+		mBones[boneNr].minimalBoneWeight = value;
+	}
+	void setBoneDirty(uint32_t boneNr, bool on)
+	{
+		mBones[boneNr].dirtyParams = on;
+	}
+	void setBoneManualShapes(uint32_t boneNr, bool on)
+	{
+		mBones[boneNr].manualShapes = on;
+	}
+	const std::vector<int> &getChildren() const
+	{
+		return mChildren;
+	}
+	const std::vector<physx::PxMat44>& getSkinningMatrices() const
+	{
+		return mSkinningMatrices;
+	}
+	const std::vector<physx::PxMat44>& getSkinningMatricesWorld() const
+	{
+		return mSkinningMatricesWorld;
+	}
+	const std::vector<SkeletalAnimation*> &getAnimations() const
+	{
+		if (mParent != NULL)
+		{
+			return mParent->getAnimations();
+		}
+		return mAnimations;
+	}
+
+	void draw(nvidia::RenderDebugInterface* batcher);
+
+	void clearShapeCount(int boneIndex = -1);
+	void incShapeCount(int boneIndex);
+	void decShapeCount(int boneIndex);
+
+	void setRagdoll(bool on);
+
+	virtual bool processElement(const char* elementName, const char* elementData, const physx::shdfnd::FastXml::AttributePairs& attr, int lineno);
+	virtual bool processComment(const char* comment) // encountered a comment in the XML
+	{
+		PX_UNUSED(comment);
+		return true;
+	}
+
+	virtual bool processClose(const char* element, uint32_t depth, bool& isError)	 // process the 'close' indicator for a previously encountered element
+	{
+		PX_UNUSED(element);
+		PX_UNUSED(depth);
+		isError = false;
+		return true;
+	}
+
+	virtual void*   fastxml_malloc(uint32_t size)
+	{
+		return ::malloc(size);
+	}
+	virtual void	fastxml_free(void* mem)
+	{
+		::free(mem);
+	}
+
+private:
+	void init(bool firstTime);
+	void initBindPoses(int boneNr, const physx::PxVec3& scale);
+	void setAnimPoseRec(int animNr, int boneNr, float time, bool lockBoneTranslation);
+
+	void interpolateBonePose(int animNr, int boneNr, float time, physx::PxTransform& pose, physx::PxVec3& scale);
+	int  findBone(const std::string& name);
+	void setupConnectivity();
+
+	// skeleton
+	std::vector<SkeletalBone> mBones;
+	std::vector<physx::PxMat44> mSkinningMatrices;
+	std::vector<physx::PxMat44> mSkinningMatricesWorld;
+	std::vector<int> mChildren;
+
+	// animation
+	std::vector<SkeletalAnimation*> mAnimations;
+	std::vector<BoneKeyFrame> mKeyFrames;
+
+	const SkeletalAnim* mParent;
+
+	bool ragdollMode;
+};
+
+} // namespace Samples
+
+#endif
diff --git a/APEX_1.4/shared/external/include/SubmitComplete.h b/APEX_1.4/shared/external/include/SubmitComplete.h
new file mode 100644
index 00000000..dc865be0
--- /dev/null
+++ b/APEX_1.4/shared/external/include/SubmitComplete.h
@@ -0,0 +1,21 @@
+/*
+ * Copyright (c) 2008-2015, NVIDIA CORPORATION.  All rights reserved.
+ *
+ * NVIDIA CORPORATION and its licensors retain all intellectual property
+ * and proprietary rights in and to this software, related documentation
+ * and any modifications thereto.  Any use, reproduction, disclosure or
+ * distribution of this software and related documentation without an express
+ * license agreement from NVIDIA CORPORATION is strictly prohibited.
+ */
+
+
+#ifndef SUBMITCOMPLETE_H
+#define SUBMITCOMPLETE_H
+
+#if PX_PS4
+#include "PS4/SubmitCompletePS4.h"
+#else
+#define SUBMIT_COMPLETE
+#endif
+
+#endif //SUBMITCOMPLETE_H
diff --git a/APEX_1.4/shared/external/include/TextRenderResourceManager.h b/APEX_1.4/shared/external/include/TextRenderResourceManager.h
new file mode 100644
index 00000000..290d866c
--- /dev/null
+++ b/APEX_1.4/shared/external/include/TextRenderResourceManager.h
@@ -0,0 +1,133 @@
+/*
+ * Copyright (c) 2008-2015, NVIDIA CORPORATION.  All rights reserved.
+ *
+ * NVIDIA CORPORATION and its licensors retain all intellectual property
+ * and proprietary rights in and to this software, related documentation
+ * and any modifications thereto.  Any use, reproduction, disclosure or
+ * distribution of this software and related documentation without an express
+ * license agreement from NVIDIA CORPORATION is strictly prohibited.
+ */
+
+
+#ifndef TEXT_RENDER_RESOURCE_MANAGER_H
+#define TEXT_RENDER_RESOURCE_MANAGER_H
+
+#include "UserRenderVertexBuffer.h"
+#include "UserRenderIndexBuffer.h"
+#include "UserRenderIndexBufferDesc.h"
+#include "UserRenderBoneBuffer.h"
+#include "UserRenderInstanceBuffer.h"
+#include "UserRenderSpriteBuffer.h"
+#include "UserRenderSurfaceBuffer.h"
+
+#include "UserRenderResourceManager.h"
+#include "UserRenderer.h"
+
+#include <stdio.h>
+#include <map>
+
+class Writer
+{
+public:
+	Writer(FILE* outputFile);
+	virtual ~Writer();
+
+	virtual void printAndScan(const char* format);
+	virtual void printAndScan(const char* format, const char* arg);
+	virtual void printAndScan(const char* format, int arg);
+	virtual void printAndScan(float tolerance, nvidia::apex::RenderVertexSemantic::Enum s, const char* format, float arg);
+
+	const char* semanticToString(nvidia::apex::RenderVertexSemantic::Enum semantic);
+	const char* semanticToString(nvidia::apex::RenderBoneSemantic::Enum semantic);
+
+	void writeElem(const char* name, unsigned int val);
+	void writeArray(nvidia::apex::RenderDataFormat::Enum format, unsigned int stride, unsigned int numElements, const void* data, float tolerance, nvidia::apex::RenderVertexSemantic::Enum s);
+
+protected:
+	FILE* mReferenceFile;
+	FILE* mOutputFile;
+	bool mIsStdout;
+};
+
+
+
+class TextRenderResourceManager : public nvidia::apex::UserRenderResourceManager
+{
+protected:
+	TextRenderResourceManager();
+
+public:
+
+	TextRenderResourceManager(int verbosity, const char* outputFilename);
+	~TextRenderResourceManager();
+
+	virtual nvidia::apex::UserRenderVertexBuffer*   createVertexBuffer(const nvidia::apex::UserRenderVertexBufferDesc& desc);
+	virtual void                                     releaseVertexBuffer(nvidia::apex::UserRenderVertexBuffer& buffer);
+
+	virtual nvidia::apex::UserRenderIndexBuffer*    createIndexBuffer(const nvidia::apex::UserRenderIndexBufferDesc& desc);
+	virtual void                                     releaseIndexBuffer(nvidia::apex::UserRenderIndexBuffer& buffer);
+
+	virtual nvidia::apex::UserRenderBoneBuffer*     createBoneBuffer(const nvidia::apex::UserRenderBoneBufferDesc& desc);
+	virtual void                                     releaseBoneBuffer(nvidia::apex::UserRenderBoneBuffer& buffer);
+
+	virtual nvidia::apex::UserRenderInstanceBuffer* createInstanceBuffer(const nvidia::apex::UserRenderInstanceBufferDesc& desc);
+	virtual void                                     releaseInstanceBuffer(nvidia::apex::UserRenderInstanceBuffer& buffer);
+
+	virtual nvidia::apex::UserRenderSpriteBuffer*   createSpriteBuffer(const nvidia::apex::UserRenderSpriteBufferDesc& desc);
+	virtual void                                     releaseSpriteBuffer(nvidia::apex::UserRenderSpriteBuffer& buffer);
+
+	virtual nvidia::apex::UserRenderSurfaceBuffer*	 createSurfaceBuffer( const nvidia::apex::UserRenderSurfaceBufferDesc &desc );
+	virtual void									 releaseSurfaceBuffer( nvidia::apex::UserRenderSurfaceBuffer &buffer );
+
+	virtual nvidia::apex::UserRenderResource*       createResource(const nvidia::apex::UserRenderResourceDesc& desc);
+	virtual void                                     releaseResource(nvidia::apex::UserRenderResource& resource);
+
+	virtual uint32_t                             getMaxBonesForMaterial(void* material);
+
+	unsigned int									 material2Id(void* material);
+
+	void											 setVerbosity(int v) { mVerbosity = v; }
+	int												 getVerbosity() { return mVerbosity; }
+
+	virtual float									 getVBTolerance(nvidia::apex::RenderVertexSemantic::Enum /*s*/) 
+	{ 
+		return 0.0f; 
+	}
+	virtual float									 getRenderPoseTolerance() { return 0.0f; }
+	virtual float									 getBonePoseTolerance() { return 0.0f; }
+
+	virtual bool									getSpriteLayoutData(uint32_t spriteCount, 
+																		uint32_t spriteSemanticsBitmap, 
+																		nvidia::apex::UserRenderSpriteBufferDesc* bufferDesc);
+	virtual bool									getInstanceLayoutData(uint32_t particleCount, 
+																		uint32_t particleSemanticsBitmap, 
+																		nvidia::apex::UserRenderInstanceBufferDesc* bufferDesc);
+protected:
+
+	int mVerbosity;
+	FILE* mOutputFile;
+	Writer* mIO;
+
+	std::map<void*, unsigned int> mMaterial2Id;
+
+	int mVertexBufferCount;
+	int mIndexBufferCount;
+	int mBoneBufferCount;
+	int mInstanceBufferCount;
+	int mSpriteBufferCount;
+	int mRenderResourceCount;
+	int mSurfaceBufferCount;
+};
+
+
+
+class TextUserRenderer : public nvidia::apex::UserRenderer
+{
+public:
+	TextUserRenderer() {}
+	virtual ~TextUserRenderer() {}
+
+	virtual void renderResource(const nvidia::apex::RenderContext& context);
+};
+
+#endif // TEXT_RENDER_RESOURCE_MANAGER_H
diff --git a/APEX_1.4/shared/external/include/TriangleMesh.h b/APEX_1.4/shared/external/include/TriangleMesh.h
new file mode 100644
index 00000000..ea513091
--- /dev/null
+++ b/APEX_1.4/shared/external/include/TriangleMesh.h
@@ -0,0 +1,529 @@
+/*
+ * Copyright (c) 2008-2015, NVIDIA CORPORATION.  All rights reserved.
+ *
+ * NVIDIA CORPORATION and its licensors retain all intellectual property
+ * and proprietary rights in and to this software, related documentation
+ * and any modifications thereto.  Any use, reproduction, disclosure or
+ * distribution of this software and related documentation without an express
+ * license agreement from NVIDIA CORPORATION is strictly prohibited.
+ */
+
+#ifndef TRIANGLE_MESH_H
+#define TRIANGLE_MESH_H
+
+
+#include <RenderMeshAsset.h>
+#include <UserRenderResourceManager.h>
+
+#include <vector>
+#include <string>
+
+#include "PsFastXml.h"
+#include "PsAllocator.h"
+
+#ifdef __ORBIS__
+#pragma clang diagnostic push
+#pragma clang diagnostic ignored "-Wunused-private-field"
+#endif
+
+namespace nvidia
+{
+namespace apex
+{
+class ClothingPhysicalMesh;
+class RenderMeshAssetAuthoring;
+
+class ResourceCallback;
+
+class UserRenderer;
+class UserRenderResourceManager;
+class UserRenderResource;
+class UserRenderVertexBuffer;
+class UserRenderIndexBuffer;
+class UserRenderBoneBuffer;
+}
+}
+
+namespace mimp
+{
+class MeshSystemContainer;
+};
+
+namespace SampleRenderer
+{
+class Renderer;
+
+class RendererVertexBuffer;
+class RendererIndexBuffer;
+class RendererMaterial;
+class RendererMaterialInstance;
+class RendererMesh;
+class RendererMeshContext;
+}
+
+namespace SampleFramework
+{
+class SampleMaterialAsset;
+}
+
+
+namespace Samples
+{
+
+class SkeletalAnim;
+
+enum PaintChannelType
+{
+	PC_MAX_DISTANCE,
+	PC_COLLISION_DISTANCE,
+	PC_LATCH_TO_NEAREST_SLAVE,
+	PC_LATCH_TO_NEAREST_MASTER,
+	PC_NUM_CHANNELS,
+};
+
+struct MaterialResource
+{
+	physx::PxVec3 color;
+	uint32_t handle;
+	bool hasAlpha;
+	std::string name;
+};
+
+PX_INLINE void PxVec3FromArray(physx::PxVec3& out, const float arr[3])
+{
+	out = physx::PxVec3(arr[0], arr[1], arr[2]);
+};
+
+PX_INLINE void PxQuatFromArray(physx::PxQuat& out, const float arr[4])
+{
+	out.x = arr[0];
+	out.y = arr[1];
+	out.z = arr[2];
+	out.w = arr[3];
+};
+
+//------------------------------------------------------------------------------------
+struct TriangleSubMesh
+{
+	void init()
+	{
+		name = "";
+		materialName = "";
+		originalMaterialName = "";
+		mRendererMesh = NULL;
+		mRendererMeshContext = NULL;
+		mSampleMaterial = NULL;
+		mRendererMaterialReference = NULL;
+		mRendererMaterialInstance = NULL;
+		firstIndex = (uint32_t) - 1;
+		numIndices = 0;
+		color = 0xfefefeff;
+		materialResource = NULL;
+		maxBoneIndex = -1;
+		maxBonesShader = 0;
+		mRenderResource = NULL;
+		cullMode = nvidia::RenderCullMode::NONE;
+		show = true;
+		selected = false;
+		selectionActivated = false;
+		usedForCollision = false;
+		hasApexAsset = false;
+		invisible = false;
+		resourceNeedsUpdate = false;
+	}
+
+	void setMaterialReference(SampleRenderer::RendererMaterial* material, SampleRenderer::RendererMaterialInstance* materialInstance);
+	std::string name;
+	std::string materialName;
+	std::string originalMaterialName;
+
+	SampleRenderer::RendererMesh*				mRendererMesh;
+	SampleRenderer::RendererMeshContext*		mRendererMeshContext;
+	SampleFramework::SampleMaterialAsset*		mSampleMaterial;
+	SampleRenderer::RendererMaterial*			mRendererMaterialReference; // reference from the mSampleMaterial
+	SampleRenderer::RendererMaterialInstance*	mRendererMaterialInstance; // clone from the mSampleMaterial
+
+	unsigned int firstIndex;
+	unsigned int numIndices;
+	unsigned int color;
+	MaterialResource* materialResource;
+	int maxBoneIndex;
+	unsigned int maxBonesShader;
+	nvidia::apex::UserRenderResource* mRenderResource;
+	nvidia::apex::RenderCullMode::Enum cullMode;
+	bool show;
+	bool selected;
+	bool selectionActivated;
+	bool usedForCollision;
+	bool hasApexAsset;
+	bool invisible;
+	bool resourceNeedsUpdate;
+	bool operator<(const TriangleSubMesh& other) const
+	{
+		if (name == other.name)
+		{
+			return materialName < other.materialName;
+		}
+		return name < other.name;
+	}
+};
+
+// ----------------------------------------------------------------------
+struct float4
+{
+	float4() {}
+	float4(float R, float G, float B, float A) : r(R), g(G), b(B), a(A) {}
+	float r;
+	float g;
+	float b;
+	float a;
+};
+
+//------------------------------------------------------------------------------------
+struct ushort4
+{
+	unsigned short elem[4];
+};
+
+//------------------------------------------------------------------------------------
+struct TriangleEdgeSplit		// for mesh subdivision
+{
+	int adjVertNr;
+	int newVertNr;
+	int next;
+};
+
+//------------------------------------------------------------------------------------
+struct PaintedVertex
+{
+	explicit PaintedVertex()							: paintValueF32(0.0f), paintValueU32(0), color(0) {}
+	explicit PaintedVertex(unsigned int u)				: paintValueF32(0.0f), paintValueU32(u), color(0) {}
+	explicit PaintedVertex(float f)						: paintValueF32(f), paintValueU32(0), color(0) {}
+	explicit PaintedVertex(unsigned int u, float f)		: paintValueF32(f), paintValueU32(u), color(0) {}
+
+	void setColor(float r, float g, float b)
+	{
+		union
+		{
+			unsigned int ucolor;
+			unsigned char ccolor[4];
+		};
+		ccolor[0] = (unsigned char)(r * 255);
+		ccolor[1] = (unsigned char)(g * 255);
+		ccolor[2] = (unsigned char)(b * 255);
+		ccolor[3] = 0xff;
+		color = ucolor;
+	}
+	float paintValueF32;
+	unsigned int paintValueU32;
+	unsigned int color;
+};
+
+//------------------------------------------------------------------------------------
+class TriangleMesh : public physx::shdfnd::FastXml::Callback
+{
+public:
+	TriangleMesh(uint32_t moduleIdentifier, SampleRenderer::Renderer* renderer = NULL);
+	virtual ~TriangleMesh();
+
+	void setRenderer(SampleRenderer::Renderer* renderer);
+
+	void clear(nvidia::apex::UserRenderResourceManager* rrm, nvidia::apex::ResourceCallback* rcb);
+	void loadMaterials(nvidia::apex::ResourceCallback* resourceCallback, nvidia::apex::UserRenderResourceManager* rrm,
+	                   bool dummyMaterial = false, const char* materialPrefix = NULL, const char* materialSuffix = NULL,
+	                   bool onlyVisibleMaterials = false);
+	void moveAboveGround(float level);
+	void initSingleMesh();
+
+	void copyFrom(const TriangleMesh& mesh);
+	void copyFromSubMesh(const TriangleMesh& mesh, int subMeshNr = -1, bool filterVertices = false);
+
+	bool loadFromObjFile(const std::string& filename, bool useCustomChannels);
+	bool saveToObjFile(const std::string& filename) const;
+	bool loadFromXML(const std::string& filename, bool loadCustomChannels);
+	bool saveToXML(const std::string& filename);
+	bool loadFromParent(TriangleMesh* parent);
+	bool loadFromMeshImport(mimp::MeshSystemContainer* msc, bool useCustomChannels);
+	bool saveToMeshImport(mimp::MeshSystemContainer* msc);
+
+	void initPlane(float length, float uvDist, const char* materialName);
+	void initFrom(nvidia::apex::ClothingPhysicalMesh& mesh, bool initCustomChannels);
+	void initFrom(nvidia::apex::RenderMeshAssetAuthoring& mesh, bool initCustomChannels);
+
+	void applyMorphDisplacements(const std::vector<physx::PxVec3>& displacements);
+
+	void drawPainting(PaintChannelType channelType, bool skinned, nvidia::apex::RenderDebugInterface* batcher);
+	void drawVertices(PaintChannelType channelType, float maxDistanceScaling, float collisionDistanceScaling, float pointScaling,
+	                  float vmin, float vmax, nvidia::apex::RenderDebugInterface* batcher);
+	void drawVertices(size_t boneNr, float minWeight, float pointScaling, nvidia::apex::RenderDebugInterface* batcher) const;
+	void drawNormals(float normalScale, bool activeVerticesOnly, nvidia::apex::RenderDebugInterface* batcher) const;
+	void drawTangents(float tangentScale, nvidia::apex::RenderDebugInterface* batcher) const;
+	void drawMaxDistancePartitions(float paintingScale, const float* partitions, size_t numPartitions, nvidia::apex::RenderDebugInterface* batcher);
+	void drawTetrahedrons(bool wireframe, float scale, nvidia::apex::RenderDebugInterface* batcher);
+
+	void updateRenderResources(bool rewriteBuffers, nvidia::apex::UserRenderResourceManager& rrm, void* userRenderData = 0);
+	void updateRenderResourcesInternal(bool rewriteBuffers, nvidia::apex::UserRenderResourceManager& rrm, void* userRenderData, bool createResource);
+	void dispatchRenderResources(nvidia::apex::UserRenderer& r, const physx::PxMat44& currentPose);
+
+	void updateRenderer(bool rewriteBuffers, bool overrideMaterial, bool sharedOnly = false);
+	void queueForRendering(const physx::PxMat44& currentPose, bool wireframe);
+
+	void skin(const SkeletalAnim& anim, float scale = 1.0f);
+	void unskin();
+
+	enum
+	{
+		NUM_TEXCOORDS = 4,
+	};
+
+	// accessors
+	size_t getNumSubmeshes() const
+	{
+		return mSubMeshes.size();
+	}
+	const TriangleSubMesh* getSubMesh(size_t i) const
+	{
+		if (i < mSubMeshes.size())
+		{
+			return &mSubMeshes[i];
+		}
+		return NULL;
+	}
+
+	void showSubmesh(size_t index, bool on);
+	void selectSubMesh(size_t index, bool selected);
+	void hideSubMesh(const char* submeshName, const char* materialName);
+	size_t getNumTriangles(size_t subMeshNr) const;
+	size_t getNumIndices() const
+	{
+		return mIndices.size();
+	}
+	size_t getNumVertices() const
+	{
+		return mVertices.size();
+	}
+	const std::vector<physx::PxVec3> &getVertices() const
+	{
+		return mVertices;
+	}
+	const std::vector<physx::PxVec3> &getNormals() const
+	{
+		return mNormals;
+	}
+	const std::vector<physx::PxVec3> &getTangents() const
+	{
+		return mTangents;
+	}
+	const std::vector<physx::PxVec3> &getBitangents() const
+	{
+		return mBitangents;
+	}
+	std::vector<PaintedVertex> &getPaintChannel(PaintChannelType channelType);
+	const std::vector<PaintedVertex> &getPaintChannel(PaintChannelType channelType) const;
+	float getMaximalMaxDistance() const;
+
+	const std::vector<nvidia::VertexUV> &getTexCoords(int index) const
+	{
+		PX_ASSERT(index >= 0);
+		PX_ASSERT(index < NUM_TEXCOORDS);
+		return mTexCoords[index];
+	}
+	const std::vector<unsigned short>  &getBoneIndices() const
+	{
+		return mBoneIndicesExternal;
+	}
+	const std::vector<physx::PxVec4> &getBoneWeights() const
+	{
+		return mBoneWeights;
+	}
+
+	const std::vector<uint32_t> &getIndices() const
+	{
+		return mIndices;
+	}
+
+	const std::vector<bool>& getActiveSubmeshVertices() const
+	{
+		return mActiveSubmeshVertices;
+	}
+
+	void getBounds(physx::PxBounds3& bounds) const
+	{
+		bounds = mBounds;
+	}
+
+	int getBoneAssignments(uint32_t vertNr, const uint16_t* &bones, const float* &weights) const;
+	bool hasBoneAssignments() const
+	{
+		return mBoneIndicesExternal.size() == mVertices.size() * 4;
+	}
+
+	int getMaxBoneIndex()
+	{
+		return mMaxBoneIndexExternal;
+	}
+	// manipulators
+
+	void displaceAlongNormal(float displacement);
+	bool generateTangentSpace();
+
+	void updateBounds();
+
+	void setSubMeshColor(size_t subMeshNr, uint32_t color);
+	void setSubMeshMaterialName(size_t subMeshNr, const char* materialName, nvidia::ResourceCallback* resourceCallback);
+	void setSubMeshUsedForCollision(size_t subMeshNr, bool enable);
+	void setSubMeshHasPhysics(size_t subMeshNr, bool enable);
+	void setAllColors(unsigned int color);
+
+	void subdivideSubMesh(int subMeshNr, int subdivision, bool evenOutVertexDegrees);
+	void evenOutVertexDegree(int subMeshNr, int numIters);
+
+	void setCullMode(nvidia::RenderCullMode::Enum cullMode, int32_t submeshIndex);
+
+	void updatePaintingColors(PaintChannelType channelType, float maxDistMin, float maxDistMax, unsigned int flag, nvidia::apex::RenderDebugInterface* batcher);
+
+	virtual bool processElement(const char* elementName, const char* elementData, const physx::shdfnd::FastXml::AttributePairs& attr, int lineno);
+	virtual bool processComment(const char* comment) // encountered a comment in the XML
+	{
+		PX_UNUSED(comment);
+		return true;
+	}
+
+	virtual bool processClose(const char* element, uint32_t depth, bool& isError)	 // process the 'close' indicator for a previously encountered element
+	{
+		PX_UNUSED(element);
+		PX_UNUSED(depth);
+		isError = false;
+		return true;
+	}
+
+	virtual void*   fastxml_malloc(uint32_t size)
+	{
+		return ::malloc(size);
+	}
+	virtual void	fastxml_free(void* mem)
+	{
+		::free(mem);
+	}
+
+
+	void setTextureUVOrigin(nvidia::TextureUVOrigin::Enum origin)
+	{
+		textureUvOriginChanged |= mTextureUVOrigin != origin;
+		mTextureUVOrigin = origin;
+	}
+	nvidia::TextureUVOrigin::Enum getTextureUVOrigin() const
+	{
+		return mTextureUVOrigin;
+	}
+
+	bool hasSkinningVertices();
+private:
+	void operator=(const TriangleMesh& other)
+	{
+		*this = other; /* empty */
+	}
+	void updateNormals(int subMeshNr);
+	void updateTangents();
+	void updateBoneWeights();
+	void optimizeForRendering();
+	void complete(bool useCustomChannels);
+	void hasRandomColors(size_t howmany);
+
+	void updateSubmeshInfo();
+
+	enum ParserState
+	{
+		PS_Uninitialized,
+		PS_Mesh,
+		PS_Submeshes,
+		PS_Skeleton,
+	};
+	ParserState mParserState;
+
+	// vertices
+	nvidia::UserRenderVertexBuffer* mDynamicVertexBuffer;
+	nvidia::UserRenderVertexBuffer* mStaticVertexBuffer;
+	nvidia::UserRenderIndexBuffer* mIndexBuffer;
+	nvidia::UserRenderBoneBuffer* mBoneBuffer;
+
+	std::vector<physx::PxVec3> mVertices;
+	std::vector<physx::PxVec3> mNormals;
+	std::vector<physx::PxVec3> mTangents;
+	std::vector<physx::PxVec3> mBitangents;
+
+	std::vector<PaintedVertex>	mPaintChannels[PC_NUM_CHANNELS];
+
+	std::vector<nvidia::VertexUV> mTexCoords[NUM_TEXCOORDS];
+
+	// triangles
+	std::vector<TriangleSubMesh> mSubMeshes;
+	std::vector<uint32_t> mIndices;
+
+	// skeleton binding
+	std::string mSkeletonFile;
+	std::vector<unsigned short> mBoneIndicesExternal;
+	std::vector<unsigned short> mBoneIndicesInternal;
+	std::vector<physx::PxVec4> mBoneWeights;
+	std::vector<uint32_t> mNumBoneWeights;
+
+	std::vector<physx::PxVec3> mSkinnedVertices;
+	std::vector<physx::PxVec3> mSkinnedNormals;
+
+	std::vector<int> mBoneMappingInt2Ext;
+	std::vector<physx::PxMat44> mSkinningMatrices; // PH: VERY CAREFUL WHEN CHANGING THIS!!! The bone buffer doesn't validate types in writeBuffer calls!
+
+	// others
+	std::string mName;
+	physx::PxBounds3 mBounds;
+
+	int mMaxBoneIndexInternal;
+	int mMaxBoneIndexExternal;
+
+	// submesh info for per-vertex drawing
+	std::vector<bool> mActiveSubmeshVertices;
+
+	// temporary, used in painting
+	std::vector<int> mTriangleMarks;
+	std::vector<int> mVertexMarks;
+	int mNextMark;
+
+	TriangleMesh* mParent;
+
+	// temporary, subdivision data structures
+	int addSplitVert(int vertNr0, int vertNr1);
+	std::vector<int> mVertexFirstSplit;
+	std::vector<TriangleEdgeSplit> mVertexSplits;
+
+	bool vertexValuesChangedDynamic;
+	bool vertexValuesChangedStatic;
+	bool vertexCountChanged;
+	bool indicesChanged;
+	bool skinningMatricesChanged;
+	bool oneCullModeChanged;
+	bool textureUvOriginChanged;
+
+	std::vector<uint32_t> mRandomColors;
+
+	std::string mMaterialPrefix;
+	std::string mMaterialSuffix;
+
+	nvidia::apex::TextureUVOrigin::Enum mTextureUVOrigin;
+
+	SampleRenderer::Renderer*				mRenderer;
+	SampleRenderer::RendererVertexBuffer*	mRendererVertexBufferDynamic;
+	SampleRenderer::RendererVertexBuffer*	mRendererVertexBufferShared;
+	SampleRenderer::RendererIndexBuffer*	mRendererIndexBuffer;
+	physx::PxMat44	mRendererTransform;
+
+	SampleFramework::SampleMaterialAsset*	mOverrideMaterial;
+	bool mUseGpuSkinning;
+};
+
+} // namespace Samples
+
+#ifdef __ORBIS__
+#pragma clang diagnostic pop
+#endif
+
+#endif
diff --git a/APEX_1.4/shared/external/include/UserAllocator.h b/APEX_1.4/shared/external/include/UserAllocator.h
new file mode 100644
index 00000000..ad633259
--- /dev/null
+++ b/APEX_1.4/shared/external/include/UserAllocator.h
@@ -0,0 +1,70 @@
+/*
+ * Copyright (c) 2008-2015, NVIDIA CORPORATION.  All rights reserved.
+ *
+ * NVIDIA CORPORATION and its licensors retain all intellectual property
+ * and proprietary rights in and to this software, related documentation
+ * and any modifications thereto.  Any use, reproduction, disclosure or
+ * distribution of this software and related documentation without an express
+ * license agreement from NVIDIA CORPORATION is strictly prohibited.
+ */
+
+
+#ifndef USERALLOCATOR_H
+#define USERALLOCATOR_H
+
+#include "ApexDefs.h"
+#include "PxAllocatorCallback.h"
+#include "ApexUsingNamespace.h"
+
+#pragma warning(push)
+#pragma warning(disable:4512)
+
+#if PX_CHECKED || defined(_DEBUG)
+#if PX_WINDOWS_FAMILY
+#define USE_MEM_TRACKER
+#endif
+#endif
+
+namespace MEM_TRACKER
+{
+	class MemTracker;
+};
+
+/* User allocator for APEX and 3.0 PhysX SDK */
+class UserPxAllocator : public physx::PxAllocatorCallback
+{
+public:
+	UserPxAllocator(const char* context, const char* dllName, bool useTrackerIfSupported = true);
+	virtual		   ~UserPxAllocator();
+
+	uint32_t	getHandle(const char* name);
+
+
+	void*			allocate(size_t size, const char* typeName, const char* filename, int line);
+	void			deallocate(void* ptr);
+
+	size_t			getAllocatedMemoryBytes()
+	{
+		return mMemoryAllocated;
+	}
+
+	static bool dumpMemoryLeaks(const char* filename);
+
+private:
+	bool				trackerEnabled() const { return mUseTracker && (NULL != mMemoryTracker); }
+
+	const char*			mContext;
+	size_t				mMemoryAllocated;
+	const bool			mUseTracker;
+
+	static MEM_TRACKER::MemTracker	*mMemoryTracker;
+	static int gMemoryTrackerClients;
+
+	// Poor man's memory leak check
+	static unsigned int mNumAllocations;
+	static unsigned int mNumFrees;
+};
+
+#pragma warning(pop)
+
+#endif
diff --git a/APEX_1.4/shared/external/include/UserErrorCallback.h b/APEX_1.4/shared/external/include/UserErrorCallback.h
new file mode 100644
index 00000000..14fe7651
--- /dev/null
+++ b/APEX_1.4/shared/external/include/UserErrorCallback.h
@@ -0,0 +1,82 @@
+/*
+ * Copyright (c) 2008-2015, NVIDIA CORPORATION.  All rights reserved.
+ *
+ * NVIDIA CORPORATION and its licensors retain all intellectual property
+ * and proprietary rights in and to this software, related documentation
+ * and any modifications thereto.  Any use, reproduction, disclosure or
+ * distribution of this software and related documentation without an express
+ * license agreement from NVIDIA CORPORATION is strictly prohibited.
+ */
+
+
+#ifndef USER_ERROR_CALLBACK_H
+#define USER_ERROR_CALLBACK_H
+
+#include "PxErrorCallback.h"
+#include "PxErrors.h"
+#include <PsString.h>
+#include <ApexUsingNamespace.h>
+
+#include <map>
+#include <string>
+#include <vector>
+
+
+class UserErrorCallback : public physx::PxErrorCallback
+{
+public:
+	UserErrorCallback(const char* filename, const char* mode, bool header, bool reportErrors);
+	~UserErrorCallback();
+
+	void		printError(const char* message, const char* errorCode = NULL, const char* file = NULL, int line = 0);
+	void		reportError(physx::PxErrorCode::Enum code, const char* message, const char* file, int line);
+	void		printError(physx::PxErrorCode::Enum code, const char* file, int line, const char* fmt, ...);
+	int			getNumErrors();
+	void		clearErrorCounter();
+	const char*	getFirstEror();
+	void		addFilteredMessage(const char* msg, bool fullMatch, bool* trigger = NULL);
+
+	void		reportErrors(bool enabled);
+
+	static UserErrorCallback* instance()
+	{
+		if (!s_instance)
+		{
+			// Allocate a stub (bitbucket) error handler
+			s_instance = ::new UserErrorCallback(NULL, NULL, false, false);
+		}
+		return s_instance;
+	}
+
+private:
+	bool	messageFiltered(const char * code, const char * msg);
+	void	openFile();
+
+	uint32_t				mNumErrors;
+	FILE*						mOutFile;
+	std::string					mOutFileName;
+	const char*					mOutFileMode;
+	bool						mOutFileHeader;
+	bool						mReportErrors;
+	char						mFirstErrorBuffer[2048];
+	bool						mFirstErrorBufferUpdated;
+
+	std::map<std::string, bool*> mFilteredMessages;
+	std::vector<std::pair<std::string, bool*> >	mFilteredParts;
+
+	static UserErrorCallback* s_instance;
+};
+
+// gcc uses names ...s
+#define ERRORSTREAM_INVALID_PARAMETER(_A, ...) \
+	UserErrorCallback::instance()->printError(physx::PxErrorCode::eINVALID_PARAMETER, __FILE__, __LINE__, _A, ##__VA_ARGS__)
+#define ERRORSTREAM_INVALID_OPERATION(_A, ...) \
+	UserErrorCallback::instance()->printError(physx::PxErrorCode::eINVALID_OPERATION, __FILE__, __LINE__, _A, ##__VA_ARGS__)
+#define ERRORSTREAM_DEBUG_ERROR(_A, ...) \
+	UserErrorCallback::instance()->printError(physx::PxErrorCode::eINTERNAL_ERROR   , __FILE__, __LINE__, _A, ##__VA_ARGS__)
+#define ERRORSTREAM_DEBUG_INFO(_A, ...) \
+	UserErrorCallback::instance()->printError(physx::PxErrorCode::eDEBUG_INFO       , __FILE__, __LINE__, _A, ##__VA_ARGS__)
+#define ERRORSTREAM_DEBUG_WARNING(_A, ...) \
+	UserErrorCallback::instance()->printError(physx::PxErrorCode::eDEBUG_WARNING    , __FILE__, __LINE__, _A, ##__VA_ARGS__)
+
+#endif
diff --git a/APEX_1.4/shared/external/include/htmltable.h b/APEX_1.4/shared/external/include/htmltable.h
new file mode 100644
index 00000000..1cc25a06
--- /dev/null
+++ b/APEX_1.4/shared/external/include/htmltable.h
@@ -0,0 +1,90 @@
+/*
+ * Copyright (c) 2008-2015, NVIDIA CORPORATION.  All rights reserved.
+ *
+ * NVIDIA CORPORATION and its licensors retain all intellectual property
+ * and proprietary rights in and to this software, related documentation
+ * and any modifications thereto.  Any use, reproduction, disclosure or
+ * distribution of this software and related documentation without an express
+ * license agreement from NVIDIA CORPORATION is strictly prohibited.
+ */
+
+
+#ifndef HTML_TABLE_H
+
+#define HTML_TABLE_H
+
+#include "PxSimpleTypes.h"
+
+// only compile this source code under windows!
+
+#if PX_WINDOWS_FAMILY
+// A simple code snippet to create an HTML document with multiple tables in it.
+//
+
+namespace nvidia
+{
+
+enum HtmlSaveType
+{
+  HST_SIMPLE_HTML,       // just a very simple HTML document containing the tables.
+  HST_CSV,               // Saves the Tables out as comma seperated value text
+  HST_TEXT,              // Saves the tables out in human readable text format.
+  HST_TEXT_EXTENDED,     // Saves the tables out in human readable text format, but uses the MS-DOS style extended ASCII character set for the borders.
+  HST_CPP,               // Save the document out as C++ code that can re-create it.  This is used for debugging the system.
+  HST_XML,               // Save the document into an easily digestable XML format.
+};
+
+class HtmlDocument;
+class HtmlTableInterface;
+
+class HtmlTable
+{
+public:
+  virtual void                setColumnColor(unsigned int column,unsigned int color) = 0; // set a color for a specific column.
+  virtual void                setHeaderColor(unsigned int color) = 0;              // color for header lines
+  virtual void                setFooterColor(unsigned int color) = 0;             // color for footer lines
+  virtual void                setBodyColor(unsigned int color) = 0;
+  virtual void                addHeader(const char *fmt,...) = 0;      // Add a column header, each column designtated by CSV.  If any single colum has a forward slash, it is treated as a multi-line header.
+  virtual void                addColumn(const char *data) = 0 ;      // add this single string to the next column. Also an optional 'color' that will control the background color of this column, starting with the current row.
+  virtual void                addColumn(float v) = 0 ;               // will add this floating point number, nicely formatted
+  virtual void                addColumn(int v) = 0;                 // will add this integer number nicely formatted.
+  virtual void                addColumn(unsigned int v) = 0;                 // will add this integer number nicely formatted.
+  virtual void                addColumnHex(unsigned int v) = 0;                 // will add this as a hex string.
+  virtual void                addCSV(bool newRow,const char *fmt,...) = 0;       // add this line of data as a set of columns, using the comma character as a seperator.
+  virtual void                nextRow(void) = 0;                         // advance to the next row.
+  virtual HtmlDocument       *getDocument(void) = 0;                     // return the parent document.
+  virtual HtmlTableInterface *getHtmlTableInterface(void) = 0;
+  virtual void                computeTotals(void) = 0; // compute and display totals of numeric columns when displaying this table.
+  virtual void                excludeTotals(unsigned int column) = 0; // Column's are 1 base indexing.  Specifies a column to *excude* from totals, even if it contains numeric data.
+  virtual void                addSort(const char *sort_name,unsigned int primary_key,bool primary_ascending,unsigned int secondary_key,bool secondary_ascending) = 0; // adds a sorted result.  You can set up mulitple sort requests for a single table.
+  virtual unsigned int               getColor(unsigned int column,bool isHeader,bool isFooter)= 0; // returns color for this column, or header, or footer
+  virtual void                setOrder(unsigned int order) = 0;
+};
+
+class HtmlDocument
+{
+public:
+  virtual HtmlTable *    createHtmlTable(const char *heading) = 0;              // create a table and add it to the HTML document.
+  virtual const char *   saveDocument(size_t &len,HtmlSaveType type) =0; // save the document to memory, return a pointer to that memory and the length of the file.
+  virtual bool           saveExcel(const char *fname) = 0; // excel format can only be saved directly to files on disk, as it needs to create a sub-directory for the intermediate files.
+  virtual void           releaseDocumentMemory(const char *mem) = 0;           // release memory previously allocated for a document save.
+  virtual HtmlTableInterface *getHtmlTableInterface(void) = 0;
+};
+
+class HtmlTableInterface
+{
+public:
+  virtual HtmlDocument * createHtmlDocument(const char *document_name) = 0;    // create an HTML document.
+  virtual void           releaseHtmlDocument(HtmlDocument *document) = 0;      // release a previously created HTML document
+}; // end of namespace
+
+
+HtmlTableInterface *getHtmlTableInterface(void);
+int                 getHtmlMemoryUsage(void);
+
+
+};
+
+#endif
+
+#endif
diff --git a/APEX_1.4/shared/external/include/linux/DirEntry.h b/APEX_1.4/shared/external/include/linux/DirEntry.h
new file mode 100644
index 00000000..19721f3e
--- /dev/null
+++ b/APEX_1.4/shared/external/include/linux/DirEntry.h
@@ -0,0 +1,162 @@
+/*
+ * Copyright (c) 2008-2015, NVIDIA CORPORATION.  All rights reserved.
+ *
+ * NVIDIA CORPORATION and its licensors retain all intellectual property
+ * and proprietary rights in and to this software, related documentation
+ * and any modifications thereto.  Any use, reproduction, disclosure or
+ * distribution of this software and related documentation without an express
+ * license agreement from NVIDIA CORPORATION is strictly prohibited.
+ */
+
+
+#ifndef DIR_ENTRY_H
+#define DIR_ENTRY_H
+
+#include "foundation/PxPreprocessor.h"
+
+#if defined PX_LINUX || defined PX_ANDROID
+#	include <dirent.h>
+#	include <sys/types.h>
+#	include <sys/stat.h>
+#	include <string>
+#	include <sstream>
+#else
+#	error Unsupported platform
+#endif
+
+namespace physx
+{
+	class DirEntry
+	{
+	public:
+
+		DirEntry()
+		{
+			mDir = NULL;
+			mEntry = NULL;
+			mIdx = 0;
+			mCount = 0;
+		}
+
+		~DirEntry()
+		{
+			if (!isDone())
+			{
+				while (next());
+			}
+
+			// The Find.cpp loop behaves badly and doesn't cleanup the DIR pointer
+			if (mDir)
+			{
+				closedir(mDir);
+				mDir = NULL;
+			}
+		}
+
+		// Get successive element of directory.
+		// Returns true on success, error otherwise.
+		bool next()
+		{
+			if (mIdx < mCount)
+			{
+				mEntry = readdir(mDir);
+				++mIdx;
+			}
+			else
+			{
+				bool ret = (0 == closedir(mDir));
+				mDir = NULL;
+				mEntry = NULL;
+				return ret;
+			}
+			return true;
+		}
+
+		// No more entries in directory?
+		bool isDone() const
+		{
+			return mIdx >= mCount;
+
+		}
+
+		// Is this entry a directory?
+		bool isDirectory() const
+		{
+			if (mEntry)
+			{
+				if(DT_UNKNOWN == mEntry->d_type)
+				{
+					// on some fs d_type is DT_UNKNOWN, so we need to use stat instead
+					std::ostringstream path;
+					path << mDirPath << "/" << mEntry->d_name;
+					struct stat s;
+					if(stat(path.str().c_str(), &s) == 0)
+					{
+						return S_ISDIR(s.st_mode);
+					}
+					else 
+					{
+						return false;
+					}
+				}
+				else 
+				{
+					return DT_DIR == mEntry->d_type;
+				}
+			}
+			else
+			{
+				return false;
+			}
+		}
+
+		// Get name of this entry.
+		const char* getName() const
+		{
+			if (mEntry)
+			{
+				return mEntry->d_name;
+			}
+			else
+			{
+				return NULL;
+			}
+		}
+
+		// Get first entry in directory.
+		static bool GetFirstEntry(const char* path, DirEntry& dentry)
+		{
+			dentry.mDir = opendir(path);
+			dentry.mDirPath.assign(path, strlen(path));
+			if (!dentry.mDir)
+			{
+				return false;
+			}
+
+			dentry.mIdx = 0;
+
+			// count files
+			dentry.mCount = 0;
+			if (dentry.mDir != NULL)
+			{
+				while (readdir(dentry.mDir))
+				{
+					dentry.mCount++;
+				}
+			}
+			closedir(dentry.mDir);
+			dentry.mDir = opendir(path);
+			dentry.mEntry = readdir(dentry.mDir);
+			return true;
+		}
+
+	private:
+
+		DIR* mDir;
+		std::string mDirPath;
+		struct dirent* mEntry;
+		long mIdx, mCount;
+	};
+}
+
+#endif